Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5w15 Olfactory Receptor

Gene Symbol Or5w15
Organism Mouse
Family 5
Subfamily w
Pseudo No
Location chr2:87737390-87738322 (-)
Aliases Olfr1138, RP23-16E8.2, MOR177-8, RP23-16E8.2, MOR177-8

Sequence information


Nucleotide sequence

ATGGATAAGGGGAACTGCTCCACATTGACAGAATTTCTCCTTTTGGGAATTACCAGTAAC
CCTGAGGTAAAAGTGTTTTTATTCACTATGTTTCTAGTTGTTTATCTTACTAATCTGCTG
ACAAATCTTGGAATGATCATTTTGATCAGAATGGATCCACAGCTTCACACACCAATGTAC
TTTTTTCTCAGCCACCTGTCTTTCTCTGATCTTTGCTATTCCACTGCAGTTGGTCCTAAG
ATGCTTGTAGACCTACTGTCTAAGAATACATCTATTCCTTTTCTTGGCTGTGCTATGCAG
TTCTTCACTTTCTGTATTTTTATAGATGCTGAGTGTGTGCTGCTGGCAGTGATGGCATTT
GATCGATATAAGGCCATTAGTAACCCCCTTTTGTATGCAGTAGACATGTCCAGGAAAGTG
TGCTTCCAATTATTGACTGGTGTTTATTCTGTGGCATTAGCAGATGCTTTGATACATACA
ACATTGACATTCCACTTATGTTTCTGTGGGTCGAATGAGATTAATCATTTCTTCTGTGAT
ATTCCTCCAGTGTTAGTACTGTCTTGTTCAGACACACAGGTCAATGTTTTAGTCATATTC
ACTGTTTTTGGTTTCATTGAACTGAGCACCATCTCAGGAGTTCTTATCTCCTACTGTTAC
ATCATCTCATCAGTTCTGAAGATCAGTTCTGCTGCTGGGAGGTTAAAAGCTTTCTCTACC
TGTACATCACACCTGACTGCTGTTGCAATTTTTCAAGGAACTATGCTCTTCATGTATTTC
CGGCCAAGTTCTTCCTACTCCCTAGATCAAGATAAAGTGACGTCCCTTTTTTATACACTT
GTGATTCCCATGCTGAACCCTCTGATTTATAGTTTGAGGAATAAAGATGTGAAAGAGGCA
CTTCAAAGAATAAGAAGTAAAATGTGTTTAAAA


Conceptual translation

MDKGNCSTLTEFLLLGITSNPEVKVFLFTMFLVVYLTNLLTNLGMIILIRMDPQLHTPMY
FFLSHLSFSDLCYSTAVGPKMLVDLLSKNTSIPFLGCAMQFFTFCIFIDAECVLLAVMAF
DRYKAISNPLLYAVDMSRKVCFQLLTGVYSVALADALIHTTLTFHLCFCGSNEINHFFCD
IPPVLVLSCSDTQVNVLVIFTVFGFIELSTISGVLISYCYIISSVLKISSAAGRLKAFST
CTSHLTAVAIFQGTMLFMYFRPSSSYSLDQDKVTSLFYTLVIPMLNPLIYSLRNKDVKEA
LQRIRSKMCLK