Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5w15 Olfactory Receptor

Gene Symbol Or5w15
Organism Rat
Family 5
Subfamily w
Pseudo No
Location chr3:75878781-75879716 (-)
Aliases Olr584, Olr584

Sequence information


Nucleotide sequence

ATGGATAACGGGAATTGCTCCTCATTGACAGAATTTCTCCTTTTGGGAATTACAAATAAC
CCCGAGGTAAAAGTATTTTTATTCATTATGTTTCTAGTTGTTTATCTCACGAATCTGCTG
ACAAATGTTGGAATGATCATTTTAATCAGAATGGATACCCAGCTCCACACACCAATGTAC
TTTTTTCTCAGCCATCTTTCTTTCTCTGATCTTTGCTATTCCACTGCAGTTGGTCCCAAG
ATGCTTGTAGACCTCCTGTCCAAGAACAGGAGGTCTATTCCTTTTCTTGGCTGTGCTATG
CAGTTCTTCACTTTCTGTATATTCATAGATGCCGAGTGTGTGCTTCTGGCAGTGATGGCA
TTTGATCGATATAAGGCCATTAGTAACCCCCTAATGTATGTAGTAGATATGTCCAGGAAA
GTGTGCTTCCAATTATTGATTGGTGTTTATTCTGTGGCATTAGCAGATGCTTTGATACAT
ACAACATTGACATTCCACTTATGCTTCTGTGGGTCTAATGAGATTAATCATTTCTTCTGT
GATATTCCTCCAGTGTTAGTACTGTCTTGTTCAGATACACAGGTCAATGTGTTAGTCATA
TTCACCGTGTTTGGTTTCATTGAACTGAGCACCATCTCTGGAGTGCTTATTTCATATTGT
TACATCATCTCATCAGTCTTGAAGATCAGCTCTGCTGCTGGGAGGATAAAGGCTTTTTCT
ACCTGTACATCACACTTGACTGCAGTTGCAATTTTTCAAGGAACTATGCTCTTCATGTAT
TTCCGGCCAAGTTCTTCCTATTCCCTAGATCAAGATAAAGTGACTTCCCTTTTTTATACA
CTTGTAATCCCCATGCTGAATCCTCTGATTTATAGTTTGAGGAATAAAGATGTGAAAGAT
GCACTCCAAAGAATAAGAAGCAAAATGTGTTTAAAA


Conceptual translation

MDNGNCSSLTEFLLLGITNNPEVKVFLFIMFLVVYLTNLLTNVGMIILIRMDTQLHTPMY
FFLSHLSFSDLCYSTAVGPKMLVDLLSKNRRSIPFLGCAMQFFTFCIFIDAECVLLAVMA
FDRYKAISNPLMYVVDMSRKVCFQLLIGVYSVALADALIHTTLTFHLCFCGSNEINHFFC
DIPPVLVLSCSDTQVNVLVIFTVFGFIELSTISGVLISYCYIISSVLKISSAAGRIKAFS
TCTSHLTAVAIFQGTMLFMYFRPSSSYSLDQDKVTSLFYTLVIPMLNPLIYSLRNKDVKD
ALQRIRSKMCLK