Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5w16 Olfactory Receptor

Gene Symbol Or5w16
Organism Mouse
Family 5
Subfamily w
Pseudo No
Location chr2:87746198-87747130 (+)
Aliases Olfr1140, RP23-16E8.3, MOR177-6, RP23-16E8.3, MOR177-6

Sequence information


Nucleotide sequence

ATGGATGAAGGAAACTGCTCCTCCATCACTGAATTTATTCTACTGGGAATCACTGATGAC
CCTAGCATGAAAGTGGTTCTATTCATTTCATTTCTTATCATCTATCTCATTATTCTTGTG
GCAAATATTGGAATTATTGTTTTGATCAGAATAGATCCTCAGCTTCACACACCAATGTAC
TTCTTCCTCAGCCATCTCTCTTTCTCAGACCTCTGTTATTCCACTGCTGTTGGACCAAAG
ATGCTGGTAGATTTACTGGCCAAACACAAATCTTTATCTTTTTTGGGCTGTGCATTACAG
TTTTTCTTTACCTGTGTCTTTATAGATGTTGAGTGTGTGCTGCTGGCAGTGATGGCCTTT
GATCGGTACAAGGCCATCAGCAATCCCCTGATGTATGTTGTAGACATGTCCAGTAGATTT
TGTTACCAGCTTCTGGCTGGAGTTTATGTATTAGCAATGATAGATACTCTGATGCAAACT
ATAATAACCTTTGGGTTGTGTTTCTGTAGGTCAAATGAGATTAATCATTTCTTCTGTGAT
CTTCCACCTATTCTGTTATTATCTTGCTCAGATATATATGTCAATGAATTAGCATTGTTT
GTGTTTTCTGGGTTTGTTGAGTTGTGCACTATTTCAGGACTTCTTGTTTCTTACAGTTAC
ATTATTGCATCAGTCTTGAAGATCAGCTGTGATGAGGGCAGATTCAAAGCTTTCTCCACT
TGTGCCTCCCACCTGACTGCAGTTGCAATTTTTCAGGGAACTCTGCTCTTTATGTATTTC
CGGCCAAGTTCTTCATACTCCTTAGATCAAGATAAAACAACCTCATTGTTTTATACCCTG
GTGATACCTATGCTCAACCCTCTGATTTACAGCCTGAGAAACAAGGACGTGAAAGAAGCC
CTGTACAAACTGAGAAATAAAAGGTCATTTAAA


Conceptual translation

MDEGNCSSITEFILLGITDDPSMKVVLFISFLIIYLIILVANIGIIVLIRIDPQLHTPMY
FFLSHLSFSDLCYSTAVGPKMLVDLLAKHKSLSFLGCALQFFFTCVFIDVECVLLAVMAF
DRYKAISNPLMYVVDMSSRFCYQLLAGVYVLAMIDTLMQTIITFGLCFCRSNEINHFFCD
LPPILLLSCSDIYVNELALFVFSGFVELCTISGLLVSYSYIIASVLKISCDEGRFKAFST
CASHLTAVAIFQGTLLFMYFRPSSSYSLDQDKTTSLFYTLVIPMLNPLIYSLRNKDVKEA
LYKLRNKRSFK