Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5w18 Olfactory Receptor

Gene Symbol Or5w18
Organism Rat
Family 5
Subfamily w
Pseudo No
Location chr3:75,957,600-75,958,500 (+)
Aliases Olr590

Sequence information


Nucleotide sequence

ATGCAAAGAAGGATGGAGAGAGAAAATTGTTCCTCCTTTACTGAATTCATATTAATGGGA
ATTACCAACAACACTGAGGTAAAGGCAGCTCTATTCACAATATTTCTAGTGGTCTATCTG
ATCAACCTCATTGGGAATCTTGGAATGATTGTTTTAATTAAAGTGGATCCACAGCTACAA
ACACCAATGTACTTTTTCCTCAGTAACCTCTCCTTCTGTGATCTCTGCTATTCCTCTGCA
GTTGGTCCTAAGATGTTAACAGACATATTTGGTAATGATAAGTCAATTCCTTTTTTTGGC
TGTGCTTTGCAATTCTTCATTTCCTGTACATTTGTGGACTCTGAGTGCATACTGCTGGCA
GTGATGGCTTTTGACCGATACCAGGCCATCAGCAATCCCTTACTTTACACAACGAACATG
TCCAGCAGACTGTGCTCCTTGCTAATGGCTGGAGTCTATCTTGTAGGTGTGGCAGACTCT
TTGATCCATACAACATTGACATTTCACTTGTGTTTCTGTGGATCTAACGAAATTGATCAC
TTCTTTTGTGATATCCCTCCCATCTTACTACTGTCCTGCTCAGACACACAGGTCAATGAG
TTAGCAATATTCACAATTTTTGGGTTTATTGAACTGAGCACCATCTCAGGAGTTCTTGTC
TCCTATTGTTACATCATCTCATCAGTCTTGAAGATCAGCTCTACTGAGGGTAGGTTCAAA
GCTTTCTCTACCTGTGCTTCTCACCTGATTGCAGTTGCGATTTTCCAAGGAACTGTGCTC
TTTATGTATTTCCGGCCAAGTTCTTCTTATTCTCTTGATCAAGACAAAATGAGCTCACTG
TTTTATATCCTTGTGATACCGATGCTAAATCCTCTGATTTATAGCCTGAGGAACAAGGAT
GTGAAAGAAGCTCTGAAAAAACTGAAAAATAAGAGATGCTGT


Conceptual translation

MQRRMERENCSSFTEFILMGITNNTEVKAALFTIFLVVYLINLIGNLGMIVLIKVDPQLQ
TPMYFFLSNLSFCDLCYSSAVGPKMLTDIFGNDKSIPFFGCALQFFISCTFVDSECILLA
VMAFDRYQAISNPLLYTTNMSSRLCSLLMAGVYLVGVADSLIHTTLTFHLCFCGSNEIDH
FFCDIPPILLLSCSDTQVNELAIFTIFGFIELSTISGVLVSYCYIISSVLKISSTEGRFK
AFSTCASHLIAVAIFQGTVLFMYFRPSSSYSLDQDKMSSLFYILVIPMLNPLIYSLRNKD
VKEALKKLKNKRCC