Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5w1b Olfactory Receptor

Gene Symbol Or5w1b
Organism Mouse
Family 5
Subfamily w
Pseudo No
Location chr2:87645183-87646121 (-)
Aliases Olfr1133, RP23-463G15.10, MOR176-2, RP23-463G15.10, MOR176-2

Sequence information


Nucleotide sequence

ATGCAGTTTGAAAACTTTACCACTGTTTTTACTGAATTTGTCTTGTTAGGACTTTCTGGC
AGACAGGATGTGCAACAGGGCCTCTTTGCATTGTTCTTCCTTGTTTATGGCATAACTGTA
ATTGCTAATCTAGGGATGATCCTGCTGATCAAGTTGGACAGCAGGCTTCACACACCTATG
TACTATTTCCTGAGCAATCTGTCCTTCTGTGACATCTGCTATTCCACCATTATCTCTCCA
AAGATGCTGGCTGATTTCTTGTCTACAGAGAAGAGGATTCCTTATAATTTATGTGCTATT
CAACTGTATTTTTTCGGGGCCTTTGCAGATGTAGAATGTCTCATGCTAGCTGTCATGGCC
TATGATCATTATGTTGCCATCTGCAATCCCCTGCTCTATACAATTAAAATGTCCAAGAAG
CTCTGCATCCAGCTTGTGGCTGTTGCCTATGCAATAGGCTTGGTGGATTCAACAATCCAC
ACATCCTGTGCATTCAGATTGTCCTTCTGCAATTCAAATGTCATCAACCACTTTTTTTGT
GACCTTCCACCCTTGCTGGCCCTCTCCTGCTCAGATACATCCATCAATGAAATAGTGATG
TTCACATTAATTGGCTGTGTGGTAGGGTGTAGCATTGTCACAGTCCTTCTCTCCTACTGC
TACATCATTGCAACCATCTGCAGGATGAACTCTGCTGAAGGCAGGCACAAAGCATTTTCC
ACCTGTGCTTCCCACCTCATGGCTGTGGCCATTTTTTATGGAACTCTGCTTTTCATGTAT
TTCCGACCCAGCTCAAGTTACTCCATGGACACAGACAAAATGGCCTCTGTTTTCTACACA
GTTGTGATTCCTATGTTAAACCCACTCATCTACAGTTTGAGAAATAAGGATGTGAAGGGG
GCTCTGAAGAAGGCAATCAATATTAACTTGTGGCCTGGG


Conceptual translation

MQFENFTTVFTEFVLLGLSGRQDVQQGLFALFFLVYGITVIANLGMILLIKLDSRLHTPM
YYFLSNLSFCDICYSTIISPKMLADFLSTEKRIPYNLCAIQLYFFGAFADVECLMLAVMA
YDHYVAICNPLLYTIKMSKKLCIQLVAVAYAIGLVDSTIHTSCAFRLSFCNSNVINHFFC
DLPPLLALSCSDTSINEIVMFTLIGCVVGCSIVTVLLSYCYIIATICRMNSAEGRHKAFS
TCASHLMAVAIFYGTLLFMYFRPSSSYSMDTDKMASVFYTVVIPMLNPLIYSLRNKDVKG
ALKKAININLWPG