Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5w1c-ps Olfactory Receptor

Gene Symbol Or5w1c-ps
Organism Rat
Family 5
Subfamily w
Pseudo Yes
Location chr3:75638147-75639283 (-)
Aliases Olr572-ps, Olr572-ps

Sequence information


Nucleotide sequence

TGTTAAAAACAAAGACCAAGAGTCTAACTATGAACACAGAAAAAGTATAACTGTCAGCTT
TTCTTTCTTTATTGAAATCCAGGGTATCCAGATCCAAAGAATGAAGTTCAAGAACATCAC
TGCATTTGATGATTTTGTCTTCTTAGGACTTTCCAGCAGACAGGATGTGCAACAGGGACT
CTTTGCTTTCTTCTTCCTTGTTTATAGCGTGACTATAATTGCTAATTTAGGGATGATCCT
GCTAATCAAGTTGGACAGCAGACTTCACACACCTATGTACTATTTCCTGAGCAATCTGTC
CATCTGCGACATCTGCTACTCCTCCACAATATCTCCAAAATGCTGGCTTATTTCTTGTCT
AAAGAGAAGAGGATTCGTTATAATTTATGTGCTGTTCAAATGTATTTTTTGTGGCCTTTG
GAGATATGGAATGTCTCATGCTAGCTCTCATGGCCTATGATCGCTATGTTGCCATCTGCA
ATCCCCTGCTCTACACAATTGCAATGTCCAAGAAGGTCTGCACCCACTTTGTGGCTGTTG
CCTGTGCAGTAGGTTTGGTGGATTCAGCAATCCACACATCCTGTACATTCCGACTGTCCT
TCTGCAATTCAAATGTCATCAGCCACTTTTTCTGTGACATTCCACCCTTACTGGCCCTCT
CCTGCTCAGATACATCCATCAATGAAATACTGCTCTTCACATTTAGTACCTTAGTGATTG
CGTCCAGCGTTGTTGCTGTCCTTCTCTCCTACTGCTACATCATTGCAACCATCTGCAGGA
TGAACTCTGCTGAGGGCAGACGCAAAGCATTTTCCACTTGTGCCTCCCACCTCATGGCTG
TGGCCATTTTTCATGGAACTCTGCTTTTCATGTATTTCCGGCCCAGCACAAGTTACTCCA
TGGACACAGATAAAATGGCCTCTGTTTTCTACACAGTTGTGACTCCCATGTTAAACCCAC
TGATCTACAGTTTAAGAAATAAGGATGTGAAGGGGGCTCTGAAGAAGGCAATCAATATTT
ACTTGTGGCCTGGGTGAAATTCTATATCACATGACAAAATGAATAGAATTCTCTGACACT
GTTTATGTGTATTAATATAGATTCCCTTGTGTATAACCTTTGAAATATTCCTCCTGA


Conceptual translation

MKFKNITAFDDFVFLGLSSRQDVQQGLFAFFFLVYSVTIIANLGMILLIKLDSRLHTPMY
YFLSNLSICDICYSSTISP/MLAYFLSKEKRIRYNLCAVQMYFL/AFGDMECLMLALM
AYDRYVAICNPLLYTIAMSKKVCTHFVAVACAVGLVDSAIHTSCTFRLSFCNSNVISHFF
CDIPPLLALSCSDTSINEILLFTFSTLVIASSVVAVLLSYCYIIATICRMNSAEGRRKAF
STCASHLMAVAIFHGTLLFMYFRPSTSYSMDTDKMASVFYTVVTPMLNPLIYSLRNKDVK
GALKKAINIYLWPG