Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5w1d-ps Olfactory Receptor

Gene Symbol Or5w1d-ps
Organism Rat
Family 5
Subfamily w
Pseudo Yes
Location chr3:75,603,100-75,604,200 (-)
Aliases Olr571-ps

Sequence information


Conceptual translation

MTFKNITAFDDFVFLGLSSRQDVLQGLFAFFFVVYSVTIIANLGMILLIKLDSRLHTPMY
YFLSNLSFCDIYYSSTTSPKMLADFLSKEKRIPYNLCAVQMYFL/AFGDI*CLMLVVMA
YDHYVAICNPLLYTIAMSKKVCTQFVAVACAVGLVDSAIHTSCTFRLSFCNSNVINHFFC
DIPPLLALSCSDTSINEILLFTFSTLVFGSSVVGVLLSYCYIIATICRMNSAEGRRKAFS
TCASHLMAVAIFHGTLLFMYFRPSSSYSMDTDKMASVFYTVVTPMLNPLIYSLRNKDVKG
ALKKAININLWPG