Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5w1e-ps Olfactory Receptor

Gene Symbol Or5w1e-ps
Organism Rat
Family 5
Subfamily w
Pseudo Yes
Location chr3:75682354-75682965 (-)
Aliases Olr574-ps, Olr574-ps

Sequence information


Nucleotide sequence

ATGACATTTGAGAATTTCACTGTTTTTACTGAATTTCTCTTGTTAGGACTTTCTGGAAGA
CAGGATGTGCAACAGGGCCTCTTTGTGTTGTTCTTCTTTGTATATGGCCTAACTGTAATT
ACTAATCTAGGGATGATCCTGCTGATCAAGTTGGACAGCAGGCTTCACACATCTATGTAC
TATTTCCTGAGCAGTCTGTCCTTCTGTGACATCTGCTACTCCTCTACAATCTCTCCAAAG
ATGCTGGCTGATTTCTTGTCTAAAAAGAAGAGGATTCCTTATAATTTATGTGCTGTTCAA
ATGTATTTTTTTGCAGCCTTTGGAGATGTTGAATGCCTCATGCTAGCTGTGATGGCCTAT
GGTCGCTATGTTGCTATCTGCAATCCCTTGCTCTATACAATCGCAATGTCCAAGAAAGTC
TGCATCCAGCTTGTGGCTGTTTCCTATGCAGTAGGCTTCGTAGATTCAGCAATCCACACA
TCCTGTACATTCCGACTGTCCTTCTGCAATTCAAATGTCATCAACCACTTTTTCTGTGAC
ATTCCACCCTTGCTGGCCCTCTCCTGCTCAGATACATCCATCAATGAAATAGTGCTCTTC
ATGCTCAGTAGC


Conceptual translation

MTFENFTVFTEFLLLGLSGRQDVQQGLFVLFFFVYGLTVITNLGMILLIKLDSRLHTSMY
YFLSSLSFCDICYSSTISPKMLADFLSKKKRIPYNLCAVQMYFFAAFGDVECLMLAVMAY
GRYVAICNPLLYTIAMSKKVCIQLVAVSYAVGFVDSAIHTSCTFRLSFCNSNVINHFFCD
IPPLLALSCSDTSINEIVLFMLSS/SDRVSIVSVILSYCYIIATICRMNSAEGRRKAFS
TCASHLMAVAIFHGTLLFMYFRPSTSYSMDTDKMASVFYTVLIPMLNPLIYSLRNKDVKG
ALRKAININLWPG