Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5w20 Olfactory Receptor

Gene Symbol Or5w20
Organism Mouse
Family 5
Subfamily w
Pseudo No
Location chr2:87896177-87897130 (+)
Aliases Olfr1153, RP23-24F19.11, MOR177-7, RP23-24F19.11, MOR177-7

Sequence information


Nucleotide sequence

ATGCAGTTTATAAAACAAAGAAGAATGGAGGTTGGAAACTGTTCAGCCACTGAGTTTCTT
CTCTTGGGAATTACCAATAATCCTGTGATCAAGGTGATTTTATTTACTACTTTTCTAATT
GTTTATCTCATAATTCTTATTGAAAATCTTGGGATGATCATTTTGATAAGAATGAACTCC
CAGCTTCACACACCGATGTACTTTTTTCTCAGCCACCTCTCTTTCTCTGATATCTGTTAT
TCTACTGCAGTTGGACCCAAGATGTTGGTGGGCCTTATATTCAAGAACAATTCAATTCCA
TTTATTGACTGTGCTGTGCAGTTCTTTATCTTCTGCATTTTTACCGATGCTGAGTGTGTG
CTACTGGCAGTGATGGCTTTTGACAGGTATAAGGCCATCAGCAACCCCTTGATGTATGCG
GTAGATATGTCCAGAGTGGTATGCTATCAGCTCCTGGCTGTGGTTTATCTGGTTGGAATG
GTAGATGCTTTGACACATACAACGTTGACATTTCACTTGTGTTTCTGTCAGTCCAAAGAA
ATCAACCATTTCTTCTGTGATGTTCCTCCTCTCCTATTACTATCTTGTTCAGATACAGAG
GTCAATGAACTAGTTATATTCACCCTATTTGGGTTTATTGAGCTGAGCACCATCTCGGGA
GTCCTGGTCTCTTACTGTTACATCATCTCATCAGTTTTGAAGATTCGCTCTGCTGAGGGC
AGATTCAAAGCATTCTCCACCTGTACCTCCCATCTAACTGTTGTTGCAATTTTCCAGGGA
ACAATGCTCTTCATGTATTTCCGGCCAAGTTCTGCTTATTCCCTGGATCAAGACAAAATG
ACCTCATTATTCTATACTCTTGTGATCCCCATGCTCAACCCGTTGATTTACAGCCTCAGG
AATAAGGATGTTAAAGCAAGTGTAAAAAGGTCCCTGAAAAGTAGAATTTCATTT


Conceptual translation

MQFIKQRRMEVGNCSATEFLLLGITNNPVIKVILFTTFLIVYLIILIENLGMIILIRMNS
QLHTPMYFFLSHLSFSDICYSTAVGPKMLVGLIFKNNSIPFIDCAVQFFIFCIFTDAECV
LLAVMAFDRYKAISNPLMYAVDMSRVVCYQLLAVVYLVGMVDALTHTTLTFHLCFCQSKE
INHFFCDVPPLLLLSCSDTEVNELVIFTLFGFIELSTISGVLVSYCYIISSVLKIRSAEG
RFKAFSTCTSHLTVVAIFQGTMLFMYFRPSSAYSLDQDKMTSLFYTLVIPMLNPLIYSLR
NKDVKASVKRSLKSRISF