Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5w21-ps Olfactory Receptor

Gene Symbol Or5w21-ps
Organism Mouse
Family 5
Subfamily w
Pseudo Yes
Location chr2:87998299-87999177 (-)
Aliases Olfr1159-ps1, MOR135-23P

Sequence information


Nucleotide sequence

AACTGTTCAACCACTGAGTTCCTTCTCTTGGGAATTACCAATAAGCCCAAGATCAAGGTG
ATTTTATTTAACAGTTTTCTGTTTATCTCATTATTCTTTTTGAAAATCTTGGAATGATCA
TTTTGATAAGAATGAATACCCAGCTTCACACATTGATGTACATTTCCTTAGCCAACTCTC
TTTCTCTGATATCTCTTACTCTACTGCATTTGGTCCCAAAATGATGAATAGCCTTCAATT
ACATGTATTTGATGTTCTGTGTAGTTCTTTATCTCTAACATTTTTACAGATGCTGAGTGT
ATAATGCTAGCAGTGATGACTCTTGACAGGTATAATGCCATCAGCAACCCCTTGATGTAT
GCAGCAGATATGTTCAAGTGGTGTGCTCTCGGCTCCTGGCTGTGGTTTTATCTGTTTGGA
ATGGTAGATGCTTTGATACATACAATATTGACATTTCATCTGTGTTTCTGTGGGTTCAAA
GAAATCAACCATTTCTTCTGTGATATCCCTCCTCTCCTATCACTATTTTCCTCAGATATA
GAGGTCAATGAACTAGACATATTCATCCTATGTGAGTTTACTAAGATGAGCACCATCTCA
TGAGTCCTGGTCTTTTACTGTTACATCATCTCATTAGTCTTGAAGATCTGCTCTGCTGAG
GGCAGGTTCAAAGCAGTCTCCACCTGTACCTCCCATCCAACAACTGCTGTTGCAATTTTC
CAGGGAATGATGTCCATCATGTATTTCCAGCCAAGTTCTGCTTATTCCCTGCATCAAGAT
AAAATGACCTCATTATTCTACACTCTTGTGATCTTCATGCTCAACGCAGTGATTTATAGC
CTCAGGAATGAAGATGTTAAAGCAAGTGTAAAATGTCCC


Conceptual translation

NCSTTEFLLLGITNKPKIKVILFNSF/VYLIILFENLGMIILIRMNTQLHTLMY/FLS
QLSFSDISYSTAFGPKMM/*PSITCI*CSV*FFISNIFTDAECIMLAVMTLDRYNAISN
PLMYAADM/QVVCSRLLA\FYLFGMVDALIHTILTFHLCFCGFKEINHFFCDIPPLLS
LFSSDIEVNELDIFILCEFTKMSTIS*VLVFYCYIISLVLKICSAEGRFKAVSTCTSHPT
TAVAIFQGMMSIMYFQPSSAYSLHQDKMTSLFYTLVIFMLNAVIYSLRNEDVKASVKCP