Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5w22 Olfactory Receptor

Gene Symbol Or5w22
Organism Mouse
Family 5
Subfamily w
Pseudo No
Location chr2:87532035-87532955 (+)
Aliases Olfr153, GA_x6K02T2Q125-49033418-49034341, MOR177-5, O, GA_x6K02T2Q125-49033418-49034341, MOR177-5, O

Sequence information


Nucleotide sequence

ATGAATATAGGAAACTGTTCCTTGAATGAATTCATTTTTGTGGGAGTTACCAATAACCCA
GAGATGAAAGGGACGCTGTTTACCATATTTCTCCTCATCTATCTCATCAATCTTCTGGGA
AATATTGGAATGATCATTTTGATCAGAATGGATCCCCAGCTCCACACACCCATGTACTTT
TTCCTGAGCCACTTGTCTTTCTGTGATCTTTGCTATTCCACAGCAATTGGTCCCAAGATG
CTGGTAGATATGTTTGGCAAGAACAAGTCAATTCCTTTCTGGGGCTGTGCTGTGCAGTTC
TTCATTTCCTGTACCTTTGCAGATTCTGAGTGTGTGCTGCTGGCAGTCATGGCCTTTGAT
AGATACCAGGCCATTAGCAACCCCTTGCTCTACACAGCAAACATGTCCAGCAGGAAGTGT
TTCATGTTCATGGCTGGCGTTTACCTGGTGGGAACATCAGATGCTTTGATACATACAACT
TTGGCATTCCGTTTGTGTTTCTGCGGGTCTAATGAGATCAACCACTTCTTCTGTGATCTA
CCTCCAATTTACCTTCTCTCCTGCTCAGATACTCAAGTAAATTACCTGGCACTATTCACT
ATTTATGGCTTCCTTGAACTGAGCACCATCTCAGGAGTCCTTGTTTCTTACTGTTACATC
ATCTCATCAGTCTTAAAAATCCGTTCAACTGAAGGGAGGTTCAAAGCTTTCTCCACCTGC
ACCTCTCACTTGACTGCAGTTGCTATTTTTCAAGGAACTCTACTCTTCACGTATTTTCGA
CCAAGTTCTTCTTATTCCCTTGATCAAGACAAAATGACATCTCTATTTTATACCCTTGTG
ATTCCTATGCTGAACCCACTGATTTATAGTTTAAGGAACAAGGATGTGAAAGAGGCCTTG
GGGAAAATGAAAAGGAAAAGA


Conceptual translation

MNIGNCSLNEFIFVGVTNNPEMKGTLFTIFLLIYLINLLGNIGMIILIRMDPQLHTPMYF
FLSHLSFCDLCYSTAIGPKMLVDMFGKNKSIPFWGCAVQFFISCTFADSECVLLAVMAFD
RYQAISNPLLYTANMSSRKCFMFMAGVYLVGTSDALIHTTLAFRLCFCGSNEINHFFCDL
PPIYLLSCSDTQVNYLALFTIYGFLELSTISGVLVSYCYIISSVLKIRSTEGRFKAFSTC
TSHLTAVAIFQGTLLFTYFRPSSSYSLDQDKMTSLFYTLVIPMLNPLIYSLRNKDVKEAL
GKMKRKR