Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5w22b-ps Olfactory Receptor

Gene Symbol Or5w22b-ps
Organism Rat
Family 5
Subfamily w
Pseudo Yes
Location chr3:75,658,300-75,658,700 (+)
Aliases Olr573-ps

Sequence information


Nucleotide sequence

ATTTTGGCATTTCACTTATGTTTCTGTGGGTCTAATTAGATCAATCACTTCTTCTGTGAT
CTACCTCCACTATACCTTCTCTCCTGTTCAGATACTCAAGTAAGTTACCTGGTATTATTG
ACTATTTATGGCTTTCTTGAACTGAGAACCATTTCAGGAGTCCTTGTTTCTTACTGTTAA
ATCATTGAAATAGTCTTTAAAATCTGTTCAACTGAAGAGAGGCTCAAGGCTTTCTCCACC
TGCACCTCTCACTTGACCGCAGTTGCTATTTTTCAAGGAACTCTACTCTTCACATATTTT
CAACCAAGTTCTTCTTACTCCCTTGATCAAGACAAAATGAAATCTCTATTTTATACCCTT
GTGATTCCTATGCTGAACCCACTGAATTATAGTTTAAGGAACAAAGATGTGAAAGAGGCC
TCAGATAAAATTAAAAGAAAA


Conceptual translation

ILAFHLCFCGSN*INHFFCDLPPLYLLSCSDTQVSYLVLLTIYGFLELRTISGVLVSYC*
IIEIVFKICSTEERLKAFSTCTSHLTAVAIFQGTLLFTYFQPSSSYSLDQDKMKSLFYTL
VIPMLNPLNYSLRNKDVKEASDKIKRK