Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5w23-ps Olfactory Receptor

Gene Symbol Or5w23-ps
Organism Rat
Family 5
Subfamily w
Pseudo Yes
Location chr3:75,795,200-75,796,400 (+)
Aliases Olr580-ps

Sequence information


Conceptual translation

MFSSIVDNFLLFINNGNYSSLTEFLLL*ITNISGVKVLLFNMFLVVYLTNMLTNVGMIIL
IRMYPQLHPPMYFFPSHLSLFFFF/DLCYSTSFDPNMIIGLLSKSRRYIPF/ACVMQF
FIFCIFIDAKCVVLAVMAFDQYKAISNPLMYAVDMSRKV*FQLLTFHLCFCGSNEINHFF
CDIPPVLVLSCSDTNVSLLVICIIFFV\CFIELSTISGVLISYCYIISSGLKI\RLNV
FSTCISHLTAL\FMYLRPSSSYSLDQDKVTSFFYTLVIPMLNPLIYSLRNKDVKDALQR
IRSKM