Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5w8 Olfactory Receptor

Gene Symbol Or5w8
Organism Rat
Family 5
Subfamily w
Pseudo No
Location chr3:76035198-76036121 (+)
Aliases Olr596, Olr596

Sequence information


Nucleotide sequence

ATGGATAGGGGAAACTGCTCATCCGTGGATGAATTTATTTTCTTAGGGATTACTAATAAC
CCTGGCAAAAATGTGGCCCTGTTCACCACATTTCTATTTGTTTATCTCACTACTCTTCTT
GCCAATCTTGGAATGATCATCTTAATTAGAATGGATACTCAACTCCACACGCCCATGTAC
TTTTTTCTCAGCAATCTCTCATTTTGTGACTTTTGCTATTCCACAGCAATTGGACCCAAG
ATGCTGGTAGATCTCTTAGCTGCGGAAAAATCAATTCCTTTTGTTGGATGTGCTCTGCAG
TTTTTGATCTTCTGTGTCTTTGCAGATTCTGAATGTCTACTGCTAGCAGTGATGGCCTTT
GATAGATACCAGGCCATCAGTAACCCATTGCTCTACACAGTGAAGATGTCCAACACGGTG
TGTTCCATGCTCATGGTTGGGGTTTACTTGGTGGCAACAACAGATGGTTTGGTACACACA
ACCTTGGCATTCCGTTTATGTTTCTGTGGTTCTAATGAGATCAACCACTTCTTTTGTGAT
TTACCTCCACTTTACCTGCTCTCCTGCTCTGACATACAAGTCAATGAACTGGCCTTATTT
ATTGTTTTTGGTTTCATTGAACTGAGCACCATCTCAGGAGTTCTTGTCTCTTACTGCTAC
ATTATTTTATCAGTCCTGAACATCCGTTCTGCCGAGGGGAGGTTCAAAGCTTTCTCCACC
TGCACTTCCCATCTCACCACAGTTGCCATTTTCCAGGGAACTATGCTTTTCATGTATTTT
CGGCCAAGTTCTTCTTATTCTCTGGATCAAGATAAAATGACTTCACTGTTCTACACTCTT
GTGATTCCAATGCTGAACCCTCTGATTTATAGCCTGAGGAACAAGGATGTGAAGGAGGCC
CTGAAAAAACTGAAAATGAAAATG


Conceptual translation

MDRGNCSSVDEFIFLGITNNPGKNVALFTTFLFVYLTTLLANLGMIILIRMDTQLHTPMY
FFLSNLSFCDFCYSTAIGPKMLVDLLAAEKSIPFVGCALQFLIFCVFADSECLLLAVMAF
DRYQAISNPLLYTVKMSNTVCSMLMVGVYLVATTDGLVHTTLAFRLCFCGSNEINHFFCD
LPPLYLLSCSDIQVNELALFIVFGFIELSTISGVLVSYCYIILSVLNIRSAEGRFKAFST
CTSHLTTVAIFQGTMLFMYFRPSSSYSLDQDKMTSLFYTLVIPMLNPLIYSLRNKDVKEA
LKKLKMKM