Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5x1-ps Olfactory Receptor

Gene Symbol Or5x1-ps
Organism Mouse
Family 5
Subfamily x
Pseudo Yes
Location chr19:13511442-13511868 (+)
Aliases Olfr1479-ps1

Sequence information


Nucleotide sequence

TTCTTTCAGTTTTGTGGTAGTAACAATTATGAGGCATTCCTTTTTAAACACTGCCCCTTC
CCTTGATGTCTACAATATCACCCCCCTTCTCATTCTACTATCCACAAAATTAAGACTCTA
GTTTTTATATTGACTTTATTGGATTTTGTTGTCGCTATGTTCATTACCTTGAACTACTTA
TATCTTATGTTCATAACTATCCTAAGTGTGCACTCAGCTGATGGACAGTAGAAGGCTTAC
TTCACCTATGCATCCTGCCTTACCACTGTGTCTATCTGTTCTTGAACAATCACCTCAATG
CACTTAAAGGCCAATTCAAGTCATTCCATGGACACAGACAAAACTATACCATGGCCATCC
TGAATTCTCTTGTCTACAGCCTGAGGTACATGGTGTCAAGAGTGCATTCAATAAATCGGT
GGGGAAA


Conceptual translation

FFQFCGSNNYEAFLFKHCPFP*CLQYHPPSHSTIHKIKTLVFILTLLDFVVAMFITLNYL
YLMFITILSVHSADGQ*KAYFTYASCLTTVSICS*TITSMHLKANSSHSMDTDK/YTMA
ILNSLVYSLRYM/VKSAFNKSVGK