Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or6d13 Olfactory Receptor

Gene Symbol Or6d13
Organism Mouse
Family 6
Subfamily d
Pseudo No
Location chr6:116540359-116541435 (+)
Aliases Olfr213, MOR119-3

Sequence information


Nucleotide sequence

ATGTCTTCCCATGTCATTTACAGGTTTAAAAACACTCAGTTCTCCACCTTCAGTCATGGT
TCTGCAAAGCCCTTCAGTGACAGACAGACTGAAGAGATGGAACAGCTGATGGCAGAGGAA
ACAAGGAATAGGACATGGGTCCGGGAGTTTGTCCTTGAGGGGTTCCCTGTGGCCGAGCAC
CTGAGAATCCTCTTCTTCCTGATGCATTTGCTGGCCTACTTGGCTTCCATCATGGGCAAC
ACGCTCATAATTAGCATCACCTGCGTGGACCACCGATTGCAGACACCCATGTACTTCTTC
CTCAGCACTTACTCCTTTGTGGAGTGCTGTTTTATAACTACAGTTATCCCCCAGCTGCTC
GCCATCTTTCTGTCAGGGAGGCAAACCATCTCCTTTGTGGCTTGCTTCACACAGGCTCTT
GTGGTTTTTGTCCTGGGGGCAACTGTTTTTTTCCTCCTGGCTGTCTTATCCCTGGACCGC
TATCTGGCCATCTGCAAACCTCTACATTATCCAACCATCATGAGCCCAAGGATGTGCTTT
CTCCTTGTTACTGTGTGCTTAGTTTTGGGATTCCTCTTCATGGCTGGTCCAGTTGTGATG
CTTTCCCAGTCATCCTACTGTGGCCCCAATGTTATTCCTCACTTTTTCTGTGATTTTGGG
CCACTGGCAAATCTCTCCTGTTCAGATACCATGTCTGTTGAGATGCTGTTTTTTAACCTT
GCTTTAATTGTGCTTTTTGGTTCCCTTCTGGTAGCCATCTTTGCATACAGCAACATAGTG
GTCACAATAGTGGGTCTCCCTTCGGCCAGGGAGAGACAGAAAGCTTTTTCCACCTGTTCC
TCTCATCTCATTGTCCTCTCTCTAATGTATGGCAGCTGTGTATTTATATACATGAAGCCA
AAGCAGACAAGCAGGCTGGACACCAACCGAGAGGCTGCTCTTGTGAACATGGTAGTGACA
CCCCTTTTGAACCCTGTCATCTACACCCTGAGAAACAAGCAGGTCCACCAGGCTCTGAGG
GATGCACTGTCCAGGGTTCAATTACCCAGATATCACAGGAGCAGTGCACCTTCCCTT


Conceptual translation

MSSHVIYRFKNTQFSTFSHGSAKPFSDRQTEEMEQLMAEETRNRTWVREFVLEGFPVAEH
LRILFFLMHLLAYLASIMGNTLIISITCVDHRLQTPMYFFLSTYSFVECCFITTVIPQLL
AIFLSGRQTISFVACFTQALVVFVLGATVFFLLAVLSLDRYLAICKPLHYPTIMSPRMCF
LLVTVCLVLGFLFMAGPVVMLSQSSYCGPNVIPHFFCDFGPLANLSCSDTMSVEMLFFNL
ALIVLFGSLLVAIFAYSNIVVTIVGLPSARERQKAFSTCSSHLIVLSLMYGSCVFIYMKP
KQTSRLDTNREAALVNMVVTPLLNPVIYTLRNKQVHQALRDALSRVQLPRYHRSSAPSL