Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or6d14 Olfactory Receptor

Gene Symbol Or6d14
Organism Mouse
Family 6
Subfamily d
Pseudo No
Location chr6:116556427-116557386 (+)
Aliases Olfr214, MOR119-1

Sequence information


Nucleotide sequence

ATGGCAAAAGAAGTGGAGGTAAGGATGAAGGCGTGGAATGAGACAACAGTCCTGGAGTTT
GTCCTGGAGGGCTTCCTTGTGGCTCAGCACCTGGGCAAGGTCCTCTTCCTCGTGCACCTG
CTGGTGTATCTGGCCTCAGTCACAGGAAATACTCTCATCATCGCCATCACGTGGTCCGAT
CCTCGCCTGCAGACCCCGATGTACTTCTTCCTCAGGAGTTTCTCCTTTTGCGAGTGCTGT
TTCATCTCCACCGTTATCCCGAAGCTCCTGGCGATCTTTCTTTTTGGAGACAGAACAATT
CATTTCACTCCCTGTATCATCCAAGCGTTTTCTTTTTTGTTTCTTGGGTCCACAATTTTC
TTCCACATGGCTGTGATGTCCTTGGATCGCTACCTAGCCATTTGCAAGCCTCTGCGCTAC
CCAGCCATCATGAACCCCAGGGTCTGTTTCCTTCTGGTTTTCTTCAGCTATGTGCTTTCC
TTCATCCTAGTAACCGGTGTGATTCTGAGGCTTTCCAGGCTGTCTTTCTGTGGCTCCAAT
GTCATTCCCCACTTCTTCTGTGACCTTGGCTCCTTAATTCATCTCTCCTGTTCAGACACC
AAATCTCTTGAAAGCATGGCCTTCGGTGTCGCTGTGGTTGTCCTTTTCACATCTGTCCTT
GCGGCTATATTTGCATATAGCAACATACTAATCTCAATCATGCGTCTTCCATTGGCCAAG
GATCGACAGAAAGCTTTCTCCACCTGCTCATCCCACCTCATCGTCCTCTCTCTGATGTAT
GGCAGCTGTGTGTTTATATATGTGAAACCGAAGCAAGTGAGCAGGCTTGAATCCAACAGA
GAGGCCGCTCTCGTAAACACGGTAGTGACGCCGCTTCTGAATCCTGTCATCTATACTCTG
CGCAACAAGCAGGTCCACCAAGCTCTGAGGGACGCACTATCCAGGGTGAACTTACAGAAA


Conceptual translation

MAKEVEVRMKAWNETTVLEFVLEGFLVAQHLGKVLFLVHLLVYLASVTGNTLIIAITWSD
PRLQTPMYFFLRSFSFCECCFISTVIPKLLAIFLFGDRTIHFTPCIIQAFSFLFLGSTIF
FHMAVMSLDRYLAICKPLRYPAIMNPRVCFLLVFFSYVLSFILVTGVILRLSRLSFCGSN
VIPHFFCDLGSLIHLSCSDTKSLESMAFGVAVVVLFTSVLAAIFAYSNILISIMRLPLAK
DRQKAFSTCSSHLIVLSLMYGSCVFIYVKPKQVSRLESNREAALVNTVVTPLLNPVIYTL
RNKQVHQALRDALSRVNLQK