Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or6d15 Olfactory Receptor

Gene Symbol Or6d15
Organism Mouse
Family 6
Subfamily d
Pseudo No
Location chr6:116582015-116582944 (-)
Aliases Olfr215, MOR119-2

Sequence information


Nucleotide sequence

ATGGGAAACGGGACAACTGTCCAGGAATTTACCCTGGAGGGATTTCCTGCTGTCCAGCAC
CTGGGCAGACTTCTCTTCTCACTGAACCTGCTGGCATACCTGGCCTCCATCACCGGAAAT
GTCGTCATTGTCTCCATCATCTGCACCAGTACCCGTCTGAAAAGCCCCATGTACTTTTTC
CTCGGTGTTTTCTCCTTTGGGGAGTCTTGTTTTACAAGTGCTGTTATTCCCAAGTTGTTG
GCTATATTTCTTTTAGGGAAACAAACAATTTCCTTTGTTGCCTGTTTCATACAAACCTTT
GTCACTCTATTTATCGGGGCATTCGGTTTTTTTCTCATAGCTGTGATGTCAGTGGACAGG
TGTGTAGCTATTTGCAAGCCTCTGCATTATCCCACCATCATGGACCTGAGGACCTGCATC
CTTCTAATTATGGCCTGCCTTGCTCTGACCTTCACCCTGATCACGTGGCTAGTAGTGACG
GTATCACGGTTATCCTTCTGTGGCCCCCACGTCATCCCCCACTTCTTCTGTGACATCAGC
CCTCTGATCCACCTCTCTTGCTCTGACACCAGTTCTGCTGAAGCTCTCACGTTCGCCCTT
GCTTTGATTATTCTTTTCTCGTCTCTCATCATAACCACTATCGCATACAGCAACATAGTC
ATCACAATTGTGCGTCTCCCATCGGCTAAGGAGAGACAGAGAGCTTTTTCCACCTGCTCA
TCCCACCTCATCGTCCTCTCTCTGATGTATGGCAGCTGTGTGTTTATATATGTGAAACCG
AAGCAAATGAGCAGGCTTGAATCCAACCGAGAGGCTGCTCTTGTGAACACGGTAGTGACG
CCGCTTCTGAACCCCGTCATCTACACCCTGCGTAACAAGCAGGTCCATCAGGCTCTGAGG
GAGACTCTGAGCAGAATAAAAATATCAGGA


Conceptual translation

MGNGTTVQEFTLEGFPAVQHLGRLLFSLNLLAYLASITGNVVIVSIICTSTRLKSPMYFF
LGVFSFGESCFTSAVIPKLLAIFLLGKQTISFVACFIQTFVTLFIGAFGFFLIAVMSVDR
CVAICKPLHYPTIMDLRTCILLIMACLALTFTLITWLVVTVSRLSFCGPHVIPHFFCDIS
PLIHLSCSDTSSAEALTFALALIILFSSLIITTIAYSNIVITIVRLPSAKERQRAFSTCS
SHLIVLSLMYGSCVFIYVKPKQMSRLESNREAALVNTVVTPLLNPVIYTLRNKQVHQALR
ETLSRIKISG