Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or6f2 Olfactory Receptor

Gene Symbol Or6f2
Organism Mouse
Family 6
Subfamily f
Pseudo No
Location chr7:140176104-140177054 (+)
Aliases Olfr523, MOR104-4

Sequence information


Nucleotide sequence

ATGTCCTCAAAATACTTAATGGCTTGGAGTACTGGCCAGAACCTGTCCACACCAGGACCA
TTCATCTTGCTGGGCTTCCCGGGGCCAAGGAGCATGCGCATTGGGCTCTTCCTGCTTTTC
CTGGTCATGTATCTGCTTACAGTAGCTGGAAACCTGGCCATCATCTCCCTGGTGGGTGCC
CACAGATGCCTACAGACACCAATGTACTTCTTCCTCTGCAACCTCTCCTTCCTGGAGATC
TGGTTCACCACAGCCTGCGTGCCCAAGACCCTGGCCACGTTTGCTCCCCGGGGTGGAGCC
ATCTCCTTGGCTGGCTGTGCCACACAGATGTACTTCGTCTTTTCTCTGGGCTGTACCGAG
TATTTCCTGCTGGCTGTGATGGCTTATGACCGCTACCTGGCCATCTGCCTGCCACTGCGC
TACGGTGGCATCATGACACCTGGGCTGGCGACACGGTTGGCCCTGGGATCCTGGCTGTGT
GGCTTTTCTGCAATCATAGTTCCTGCTGCCCTCATTGCCCGCCTCTCTTTCTGCGGCTCA
CGTGTCATCAACCACTTCTTCTGTGACATTTCGCCCTGGATAGTGCTTTCCTGCACGGAC
ACGCAGGTGGTAGAGCTAGTGTCTTTTGGTATTGCCTTCTGTGTCATTCTGGGCTCCTGT
GGTATCACACTAGTCTCCTATGCCTACATCATCACTACCATCATCAAGATTCCCTCTGCC
CAGGGCCGGCACCGCGCCTTCTCTACCTGCTCATCCCATCTCACTGTGGTGCTTATTTGG
TATGGCTCTACTATCTTCTTGCACGTGAGGACCTCGGTAGAGAGCTCCTTGGACCTCACC
AAAGCTGTCACAGTGCTCAATACCATTGTCACACCCGTCTTGAACCCTTTCATATATACC
CTGAGGAACAAGGATGTGAAGGAGGCTCTGCGCAGGACAATGAAGGGGAAG


Conceptual translation

MSSKYLMAWSTGQNLSTPGPFILLGFPGPRSMRIGLFLLFLVMYLLTVAGNLAIISLVGA
HRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGAISLAGCATQMYFVFSLGCTE
YFLLAVMAYDRYLAICLPLRYGGIMTPGLATRLALGSWLCGFSAIIVPAALIARLSFCGS
RVINHFFCDISPWIVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSA
QGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVESSLDLTKAVTVLNTIVTPVLNPFIYT
LRNKDVKEALRRTMKGK