Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or6k4 Olfactory Receptor

Gene Symbol Or6k4
Organism Mouse
Family 6
Subfamily k
Pseudo No
Location chr1:174,137,000-174,138,000 (+)
Aliases Olfr424

Sequence information


Nucleotide sequence

MRINLAETIMRINRTTSVTEFLFSGFPQFEDGSFLFFIPLFFIYIFIVIGNLIVFFAVRM
DTRLHNPMYNFISIFSFLEIWYTTATIPKMLSNLISKQRTISLIGCLLQMYFFHSLGNSE
GILLTTMAIDRYVAICNPLRYPTIMTPRLCAHLSAGSCIFGFLVLLPEIAWISTLPFCGP
NQIHQIFCDFEPVLRLACTDTSMILVEDVVHAVAIIFSVLVIAISYMRIITVILRIPSGE
GRRKAFSTCAAHLGVFLMFYGSVSLMYLRFSATFPPILDTAIALMFAVLAPFFNPIIYSL
RNKDMKIAIKKLLCSQKMLPTSAS


Conceptual translation

MRINLAETIMRINRTTSVTEFLFSGFPQFEDGSFLFFIPLFFIYIFIVIGNLIVFFAVRM
DTRLHNPMYNFISIFSFLEIWYTTATIPKMLSNLISKQRTISLIGCLLQMYFFHSLGNSE
GILLTTMAIDRYVAICNPLRYPTIMTPRLCAHLSAGSCIFGFLVLLPEIAWISTLPFCGP
NQIHQIFCDFEPVLRLACTDTSMILVEDVVHAVAIIFSVLVIAISYMRIITVILRIPSGE
GRRKAFSTCAAHLGVFLMFYGSVSLMYLRFSATFPPILDTAIALMFAVLAPFFNPIIYSL
RNKDMKIAIKKLLCSQKMLPTSAS