Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or6x1 Olfactory Receptor

Gene Symbol Or6x1
Organism Mouse
Family 6
Subfamily x
Pseudo No
Location chr9:40,187,100-40,188,100 (+)
Aliases Olfr986

Sequence information


Nucleotide sequence

MRNGTAITEFILLGFPGIQGSEALLFIVIFLIYILTLSGNGLIIVIVWVEPRLQTPMYFF
LCNLAFLEIWYTTTVIPKLLETFVVSKTVICTACCLLQAFFHFFLGTTEFLILGSMSFDR
YLAICKPLRYPTIMTSNLCLQLALSSWLAGFTIVFCQTMLIVQLPFCGNNVINHFYCDVG
PILKAACADTSILELLGLLATILVIPGSLLFTIISYIYILSTILRIPSATGRQKAFSTCA
SHLTVVSLLYGAVLFMYLRPTAHSSFKINKVVSVLNTILTPLLNPFIYTIRNKEVKGALR
KAITCANRHHAK


Conceptual translation

MRNGTAITEFILLGFPGIQGSEALLFIVIFLIYILTLSGNGLIIVIVWVEPRLQTPMYFF
LCNLAFLEIWYTTTVIPKLLETFVVSKTVICTACCLLQAFFHFFLGTTEFLILGSMSFDR
YLAICKPLRYPTIMTSNLCLQLALSSWLAGFTIVFCQTMLIVQLPFCGNNVINHFYCDVG
PILKAACADTSILELLGLLATILVIPGSLLFTIISYIYILSTILRIPSATGRQKAFSTCA
SHLTVVSLLYGAVLFMYLRPTAHSSFKINKVVSVLNTILTPLLNPFIYTIRNKEVKGALR
KAITCANRHHAK