Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or7g17 Olfactory Receptor

Gene Symbol Or7g17
Organism Mouse
Family 7
Subfamily g
Pseudo No
Location chr9:18856627-18857589 (+)
Aliases Olfr829, MOR147-1

Sequence information


Nucleotide sequence

ATGTATTCCATCAGATTCACCATGAACATGAAATATATAAACCAAACGGTTGTGTCAGGA
TTCATTCTCCTGGGACTCACAGATGATACCAAGCTGCAACTTATTATCTTCAGTGTCTTT
CTTTCCATGTACCTTGCAACAGTCATAGGAAACCTCCTGATTATTCTGGCCACCAACTTT
GACTCTCATCTCCATACCCCCATGTACTTCTTTCTCTCTGTTCTTTCTTTTAATGATATC
TTTTTAGTTACATGCACTATTCCAAAGATGCTGGTGAATATACAAACAGGAAACCAGAAC
ATCACTTATGGAGGATGTCTGACTCAGGTCTGCTTTGTCTTGGTGTCTGTTGGCATGGAA
AATTGCCTTCTTGCAGCAATGGCCTATGACCGCTATGTTGCTATTTGCCATCCACTTAGG
TATAGGATCATAATGAACCCCTATCTTTGTATCCTAATGGTAGCATTTTCTATGATAGGG
AGCATGGCAAATGCCCTGGTCAATGGTCTAATGGTATTACATCTGTCCTTCTGCACAGAA
CTCATAATCCCACATTTCTTCTGTGAACTTACACAGATTACTAAACTTGCCTGTTCCAAC
ACTCTTATTGACAACATACTAATATACATTTCATCTTGCATATTTGGTGGTGTTCCTCTT
TCTGGCATCATTTTGTCATATTGTCAAATTGCAACCACTGTCTTGAGAATGTCATCATCA
GAAGGAAGATATAAAGCATTTTCCACCTGCGGGTCTCATCTGTCAGTTGTTTTCTTATTT
TATGGAACCGGTTTTGGGGTCTATATCAGCTCAACAATTACAGAATCATCCAGGAAGAGT
GCTGTGGCTTCAGTGCTGTATTCAGTAGTCCCTCAAATGATAAATCCCTTTATCTATAGT
CTGAGGAACAGAGACATGAAAGAAGCCTTGAAAAAACTCATCAGTAGGATATTATTTCCT
CTA


Conceptual translation

MYSIRFTMNMKYINQTVVSGFILLGLTDDTKLQLIIFSVFLSMYLATVIGNLLIILATNF
DSHLHTPMYFFLSVLSFNDIFLVTCTIPKMLVNIQTGNQNITYGGCLTQVCFVLVSVGME
NCLLAAMAYDRYVAICHPLRYRIIMNPYLCILMVAFSMIGSMANALVNGLMVLHLSFCTE
LIIPHFFCELTQITKLACSNTLIDNILIYISSCIFGGVPLSGIILSYCQIATTVLRMSSS
EGRYKAFSTCGSHLSVVFLFYGTGFGVYISSTITESSRKSAVASVLYSVVPQMINPFIYS
LRNRDMKEALKKLISRILFPL