Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or7g18 Olfactory Receptor

Gene Symbol Or7g18
Organism Mouse
Family 7
Subfamily g
Pseudo No
Location chr9:18875329-18876273 (+)
Aliases Olfr830, MOR152-1

Sequence information


Nucleotide sequence

ATGTCTAACATGGAAGTTGAAAACAAATCAGTTGTTTTGGATATTTTTCTACATGGACTC
ACAAATGACCCAGAGCTGCAGCCATTCATCTTTGTTCTTTTTCTAAGCATATACTTGATT
ACCGTTTCTGGAAATCTTCTTATAATGTTGGCCATCAAGTGTGACTTCCATCTTCACAAC
CCCATGTACTTCTTTCTCTGTCATCTGTCTTTTAATGACATGTATTTAATCAGCATCACA
GTCCCAAAGATGTTGATGAATATACAAACAAAAGATCAGAGGATAACTTTTGCTGGCTGC
CTCAGCCAGGCCTGCTTTGTTGTAGTTTGTACAATATTTGAATGTTTTCTCCTTGGAGTA
ATGGCTTATGATCGCTACATAGCCATTTGTTATCCTCTAAGATACACAGTCCTTATGAAC
CCCAGTTTCTGTGTTATTCTGGTTCTTTTCTCTCTATTCTTTAGTATTGTAAATGGTCTG
CTGCATAGTCTGATGGTGCTGTACTTGTCCTTCTGCACAGACCTGGAAATCCTCCACTTC
TTCTGTGAAATTGCACAAATCCTGAAGCTTGCCTGTTCTGACAGCCTCATCAACAACATC
CTGATATTTGTTACAGCTTCTATTTTTGCTGGTCTTCCTCTGTTTGCAATAATCTTTTCT
TATACTCATATTGTGTCTACAGTATTGAAAATGCCATCATCAGAAGGAAAGTACAAAGCC
TTTTCCACCTGTGGGTCTCATTTGTCAGTTGTTTCCTTATTCTATGGGACAGGGTTTGGT
GTATACATTACCTCAAAAGTAATTGATTCACCAAAGAAGATTGCTGTGGCTTCAGTGATG
TATTCAGTAGTTCCTCCAATGTTGAATCCCTTTGTCTATTGTTTGAGGAACAGGGATATG
AAGGAGGCCCTGAAGAAAGTTATTGGTAGGACAGCTTCTCTTCTG


Conceptual translation

MSNMEVENKSVVLDIFLHGLTNDPELQPFIFVLFLSIYLITVSGNLLIMLAIKCDFHLHN
PMYFFLCHLSFNDMYLISITVPKMLMNIQTKDQRITFAGCLSQACFVVVCTIFECFLLGV
MAYDRYIAICYPLRYTVLMNPSFCVILVLFSLFFSIVNGLLHSLMVLYLSFCTDLEILHF
FCEIAQILKLACSDSLINNILIFVTASIFAGLPLFAIIFSYTHIVSTVLKMPSSEGKYKA
FSTCGSHLSVVSLFYGTGFGVYITSKVIDSPKKIAVASVMYSVVPPMLNPFVYCLRNRDM
KEALKKVIGRTASLL