Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8aa1-ps Olfactory Receptor

Gene Symbol Or8aa1-ps
Organism Mouse
Family 8
Subfamily aa
Pseudo Yes
Location chr2:86529801-86530386 (-)
Aliases Olfr1078-ps1, EG257825, OTTMUSG00000013637

Sequence information


Nucleotide sequence

TTCATCCTGTTGGACATCACAAATTTCCCTAAGCTATAGGTGTCACTGTTTTGATTGTTC
TTCATCATCTATCTGATGTAATGTCAAACAGCTTGAGCGTGATCCTCATTACTGTGGTGG
ACTCCAGGTACTTCTGTCTCAGACATATACCTACTACAGTTCTTGTTTATTCAATAGCTG
TTGGAACCAAAATATAAGAAATTTTATTGTTGATCAAAAAACGGTATAGTTTAGCATTTG
TGATACACGGTTAACCTTCTATATTTGGTTAGAATATTGACTTGTAAGATTTTAATTCTG
TTTTCAATGTCCTCTGACCACTTTCTAGCCACTGTAAGCCTCTGCTCTTATGATACTCAT
ATGTCAAGAATAGTATTTTGGTTACTGGTGCAATCTTTATTTTATAGCTCAATTGTGACT
GTTCTATTCACAGTTAAGATTTTTTATTGGTTATTTTATTTGTTTACATTTCAAATGTTA
TTATCCTTCCTGCAAGCCCCCTATCACATCACTCCTCCCTCCTGCTTTTATGAGAGAGAT
TTCCCACCCATCCATCTTCTCCCTCCTCACTGCCCTAGCATTCTCC


Conceptual translation

FILLDITNFPKL*VSLF*LFFIIYLM*C/NSLSVILITVVDSRYFCLRHIPTTVLVYSI
AVGTK/IRNFIVDQKTV*FSICDTRLTFYIWL/ILTCKILILFSMSSDHFLA/CKPL
L\DTHMSRIVFWLLVQSLFYSSIVTVL\QLRFFIGYFICLHFKCYYPSCKPPITSLLP
PAFMREISHPSIFSLLTALAFS