Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8ag1-ps Olfactory Receptor

Gene Symbol Or8ag1-ps
Organism Rat
Family 8
Subfamily ag
Pseudo Yes
Location chr3:73,681,200-73,682,100 (-)
Aliases Olr497-ps

Sequence information


Conceptual translation

VTEFILLGITNESNL*/INFCIFLIIYLISLMSSLAIILITVMDSKLQTPMYFLIRHIA
TRVLVYSRTIGTKMLEIL*IKT\VF*LCNFDLVF*IFIACEIFIPFSMLYDHYVS/CK
PLF/MILMSRLCLLLVAVLIALQNCNCSIHNKIFILSLCVYKGVIPFHCNSLNLLSLVC
SNIHKIEVIMFISLDYNFIPSILASCTSYNRKLTIFSLTLLRIISLCLVFSIFIPGILPS
IL