Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8ah1-ps Olfactory Receptor

Gene Symbol Or8ah1-ps
Organism Rat
Family 8
Subfamily ah
Pseudo Yes
Location chr3:74,776,400-74,777,300 (-)
Aliases Olr494-ps

Sequence information


Conceptual translation

MIIKNILNNRLQTPMPCFLRL\FSDFLFSTAMLHRMLGNFKQMKIPSSNTVVPSLYMIF
IISSFFM\TVFAYDSYIDICKSLIYTVISQKVYWALITIPMTITIKNLIDSFCGHGIHH
FYNNSLPLFTLICSGTYDNDLTILISSAFNLLSSISIVLVYL*SSLG*ILQKEGYKAFSI
CGFHLTWKCL