Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8ai1-ps Olfactory Receptor

Gene Symbol Or8ai1-ps
Organism Rat
Family 8
Subfamily ai
Pseudo Yes
Location chr3:73783764-73784602 (-)
Aliases Olr506-ps, Olr506-ps

Sequence information


Nucleotide sequence

TATGTTACCTTTAATAGTTTATAAAAATTCCTCCAGAAATTACTAGTTGAGCTCTGATGA
TAATACGCTTGATTTAACAAAGAACATTGACCATTTTCTGGTAAGTAGGAATGGAGAAGG
TCAACTCACAGTGGTTATCCAATTCCCCCTGTTGGACAACACAAGTCTCCCAAAGCTGTA
GACACCATTGTTCAGATTGTTCCTCATCATCTCTCTGGTTACCACAGTAAACAGCTTGGG
AATGATCCTCATTACCATGGTGAGCTCCAGGCTGCATGTATTTCTTTGTCAGACAAATAG
CTATTACAGTTCTTATTTATTCAATAGCTGTTGGAACCAAAATCTTAAGAAATTTTATTG
TTGATCAAGAAACAGTATATTTTAGCATTTTTGATACATGGTTAGCCTTCCATCTTTGGC
TCGTTGGTTGGGATGTGTTAATTCTGTTTTCTAAGTCTTATGACAACTATATGATTACCA
TAAGCCTTTACTTTTATGATCCTTTCATGCCAAGAATATTATTTTGGTTACCGGTAGCAA
TCTTTATCTTTACTGTACAAGTGTGACTTTTCTACTCACTGTTAAGAAGATTTTCCCTCT
GTCTTTCCATATGTACTATGTAATCAATCATTTCTACTGTGAGAATCTTCCTTAGTTATC
TTTGATCTGTTCAAATATACACAAGATTAAAGTGATAATATTGATCCTTTCAGCTTTTAA
TTTGATTTCATCTATTCTAATTTCATGTAGCTCATGTAATAGGAAACATACCATATTTAT
CCTTGTATAATTGAGAATTATTTCATTCAGCGTTCATCTTTGTTATTCTCTGGTAACAA


Conceptual translation

EGQLTVVIQFPLLDNTSLPKL*TPLFRLFLIISLVTTVNSLGMILITMVS\GCMYFFVR
QIAITVLIYSIAVGTKILRNFIVDQETVYFSIFDTWLAFHLWLVGWDVLILFSKSYDNYM
I/HKPLLL*SFHAKNIILVTGSNLYLYCTSVTFLLTVKKIFPLSFHMYYVINHFYCENL
P*LSLICSNIHKIKVIILILSAFNLISSILISCSSCNRKHTIFILV