Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8b53 Olfactory Receptor

Gene Symbol Or8b53
Organism Rat
Family 8
Subfamily b
Pseudo No
Location chr3:158808793-158809737 (+)
Aliases Olr1259

Sequence information


Nucleotide sequence

ATGGCTTTATTAAATGGCTCTGTGGTAACTGAATTCATTCTTTTGGGATTAACAGACCAG
CCTGACCTCCAAATACCCCTGTTTCTGATCTTTCTGTTACTGTACATAATAACTGCATTA
GGGAATTTGAGTTTAATTATTCTTATTGTGCTGAATTCTCACTTACATACCCCTATGTAT
TTTTTCCTGTTTAACTTATCCTTTGTGGACTTTTGTTTTTCATCTGTAATTACCCCAAAA
ATGCTGATGAACTTTATTCTGACAAAAAATCACATCTCATATGTTGGGTGTATGACACAG
TTCTATTTATTCTGTTTCTGTGTCATTTCTGAGTGTTACATTCTCACATCAATGGCCTAC
GATCGTTATGTGGCAATCTGCAATCCACTCTTGTATAACATTGTCATGTCTCCCAAGGTG
TGTTCCTATCTTATGCTTGCTTCATATTTAATGGGGTTTTCTGGTGCTATGATCCACACT
GGATGCATCCTGAGACTGACATTTTGTGATGGAAACACCATCAACCATTACTTCTGTGAT
CTCCTTTCTTTGCTGCAGCTCTCCTGCACCAGCACCTATGTCAATGAAATAGAGTTGTTA
ATTGTAGCAGGAAAGGACATCATTCTGCCCACTGTGGTCATCTTTATTTCTTATGGCTTC
ATTCTTTTCAACATATTCCAAATGAAATCCACTGAGAGCATGTCAAAAGCCTTCAGCACC
TGCAGTTCCCACATAATTGCTGTCTCTCTTTTCTTTGGATCCGGTGCATTTATGTATCTC
AAACCTAACTCAGCTGGAAAAATGAATAATGGAAATACATCTTCAATTATCTATACCACT
TTAATTCCTATGATAAATCCATTAATTTATAGCTTGAGGAACAAAGATGTTAAAGTTGCA
TTAAGAAAAACTCTGAGAAAGAAAATTTTTAATTGGAATCTAATT


Conceptual translation

MALLNGSVVTEFILLGLTDQPDLQIPLFLIFLLLYIITALGNLSLIILIVLNSHLHTPMY
FFLFNLSFVDFCFSSVITPKMLMNFILTKNHISYVGCMTQFYLFCFCVISECYILTSMAY
DRYVAICNPLLYNIVMSPKVCSYLMLASYLMGFSGAMIHTGCILRLTFCDGNTINHYFCD
LLSLLQLSCTSTYVNEIELLIVAGKDIILPTVVIFISYGFILFNIFQMKSTESMSKAFST
CSSHIIAVSLFFGSGAFMYLKPNSAGKMNNGNTSSIIYTTLIPMINPLIYSLRNKDVKVA
LRKTLRKKIFNWNLI