Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8b54b Olfactory Receptor

Gene Symbol Or8b54b
Organism Rat
Family 8
Subfamily b
Pseudo No
Location chr3:158887412-158888350 (+)
Aliases Olr1261

Sequence information


Nucleotide sequence

ATGGTTCTAGCAAATGGTTCTACTGTGACTGAATTCATTCTTTTGGGATTAACAGACCAG
CCTGGGCTCCAAATGCCTCTTTTCTTACTGTTTTTATTAATGTATATGATAACAGTGTTT
GGTAATTTGACTTTGATAATTTTAATTGTGTTAAATGCTCACCTACATACTCCTATGTAC
TTTTTTCTCTGTAATTTATCTTTTGTAGATCTCTGTTATTCTTCTGTCATCACACCAAAA
ATGCTGATGAATTTTATACTAAAGAAGAATCTTATCTCTTATATGGGATGTATGTCCCAA
CTCTACTTCTTTTGTTTTTTTATAATTTCTGAATTCTATGTACTGGTGTCAATGGCCTAT
GATCGCTATGTTGCTATCTGTAATCCACTTTTGTATAACACTATCATGTCCCCAAGGGTG
TGTTCTTATCTCATGCTTGCTTCATATTTGATGGGATTTGCTGATGCTATGATCCACACT
GGTTGCATGCTCAGACTTAGTTTTTGTGATGAAAACATCATTAACCACTATTTCTGTGAT
TTTCTTCCTTTGCTGCAGCTCTCATGTACCAGTACCTATGTCAATGAGACAGAAATTTTC
ATTGTAGGGGGGAAAGACATCATTCTGCCCAGTGTCATAATCTTTATCTCTTATGGCTAT
ATCCTCTCCAACATTTTCCAAATAAGATCCACTCTGGGAAGGTCCAAGGCCTTCAGCACC
TGCAGTTCCCACATTACTGCTGTCTCTCTGTTCTTTGGATCCTGTGGGTTTATGTACCTG
AAACCTCCATCTGCAATATCCATTGATCAAGGAAAAATCTCTTCTATTTTTTATACCATT
GTGGTTCCTATGTTGAACCCCTTAATTTACAGCCTGAGAAACAAAGATGTTAAAGTTGCC
CTGAGAAAGATCTTGAATATGAGTAAGGTTTTTAAACTA


Conceptual translation

MVLANGSTVTEFILLGLTDQPGLQMPLFLLFLLMYMITVFGNLTLIILIVLNAHLHTPMY
FFLCNLSFVDLCYSSVITPKMLMNFILKKNLISYMGCMSQLYFFCFFIISEFYVLVSMAY
DRYVAICNPLLYNTIMSPRVCSYLMLASYLMGFADAMIHTGCMLRLSFCDENIINHYFCD
FLPLLQLSCTSTYVNETEIFIVGGKDIILPSVIIFISYGYILSNIFQIRSTLGRSKAFST
CSSHITAVSLFFGSCGFMYLKPPSAISIDQGKISSIFYTIVVPMLNPLIYSLRNKDVKVA
LRKILNMSKVFKL