Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8b54c Olfactory Receptor

Gene Symbol Or8b54c
Organism Rat
Family 8
Subfamily b
Pseudo No
Location chr2:46140482-46141420 (+)
Aliases Olr1262

Sequence information


Nucleotide sequence

ATGGTTCTAGCAAATGGTTCTACTGTGACTGAGTTCATTCTTTTGGGATTAACAGACCAG
CCTGGGCTCCAAATGCCTCTTTTCTTATTGTTTCTATTAATGTACATGATAACAGTGTTC
GGTAATTTGACTTTGATAATTTTAATTGTGTTAAATGCTCACCTACATACTCCTATGTAC
TTTTTTCTCTGTAATTTATCTTTTGTAGATCTCTGTTATTCTTCTGTCATCACACCAAAA
ATGCTGATGAATTTTATACTAAAGAAGAATCTTATCTCTTATATGGGATGTATGTCCCAA
CTCTACTTCTTTTGTTTTTTTATAATTTCTGAATGCTATGTACTGGTGTCAATGGCCTAT
GATCGCTATGTTGCTATCTGTAATCCACTTTTGTATAACACTATCATGTCCCCAAGGGTG
TGTTCTTATCTCATGCTTGCTTCATATTTGATGGGATTTGCTGATGCTATGATCCACACT
GGTTGCATGCTCAGACTTACTTTTTGTGATGAAAACATCATTAACCACTATTTCTGTGAT
GTTCTTCCTTTGCTGCAGCTCTCATGTACCAGTACCTATGTCAATGAGACAGAACTTTAC
ATTGTAGCGGGGAAAGACATCATTCTGCCCAGTGTCATAATCTTTATCTCTTATGGCTTT
ATCGTCTCCAACATTTTCCAAATAAAATCCACTCTGGGAAGGTCCAAGGCCTTCAGCACC
TGCAGTTCCCACATAATTGCTGTCTCTCTGTTCTTTGGATCATGTGGGTTTATGTACCTG
AAACCTCCCTCTGCAATATCAATTGATCAAGGAAAAATCTCTTCCATTTTTTATACCATT
GTGGTTCCTATGTTGAACCCCTTAATTTACAGCTTGAGAAACAAAGATGTTAAAGTTGCC
CTGAGAAAGATCTTGAATATGAGTAAGGTTTTTAAACTA


Conceptual translation

MVLANGSTVTEFILLGLTDQPGLQMPLFLLFLLMYMITVFGNLTLIILIVLNAHLHTPMY
FFLCNLSFVDLCYSSVITPKMLMNFILKKNLISYMGCMSQLYFFCFFIISECYVLVSMAY
DRYVAICNPLLYNTIMSPRVCSYLMLASYLMGFADAMIHTGCMLRLTFCDENIINHYFCD
VLPLLQLSCTSTYVNETELYIVAGKDIILPSVIIFISYGFIVSNIFQIKSTLGRSKAFST
CSSHIIAVSLFFGSCGFMYLKPPSAISIDQGKISSIFYTIVVPMLNPLIYSLRNKDVKVA
LRKILNMSKVFKL