Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8g35 Olfactory Receptor

Gene Symbol Or8g35
Organism Mouse
Family 8
Subfamily g
Pseudo No
Location chr9:39,469,800-39,470,700 (-)
Aliases Olfr955

Sequence information


Nucleotide sequence

MEELNHTSVTEFILAGLTENPELQLPLFLTFLSVYLFTVVGNLGMIVLILISSQLHTPMY
YLLSSLSFIDCCQSTVIVPKMLLNFVTEKNVILYPECIAQFYFFCTFVVAECHMLAAMAY
DRYVAISNPLLYKVTMSYQVCLLMVAVVYGIGLISATAHTVFLLRLFFCKADKINHYFCD
LFPLLELSCSSTFINEILALSFSAFNIIVPAMTIIGSYIFIIISILHIKSSGGRVKAFRT
CSSHILAVAIFFGSTTFMYLQPSSVSSMDQGKVSSVFYTIVVPMLNPMIYSLRNKDVKVA
LKKLLQKMFPQNKE


Conceptual translation

MEELNHTSVTEFILAGLTENPELQLPLFLTFLSVYLFTVVGNLGMIVLILISSQLHTPMY
YLLSSLSFIDCCQSTVIVPKMLLNFVTEKNVILYPECIAQFYFFCTFVVAECHMLAAMAY
DRYVAISNPLLYKVTMSYQVCLLMVAVVYGIGLISATAHTVFLLRLFFCKADKINHYFCD
LFPLLELSCSSTFINEILALSFSAFNIIVPAMTIIGSYIFIIISILHIKSSGGRVKAFRT
CSSHILAVAIFFGSTTFMYLQPSSVSSMDQGKVSSVFYTIVVPMLNPMIYSLRNKDVKVA
LKKLLQKMFPQNKE