Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8g37 Olfactory Receptor

Gene Symbol Or8g37
Organism Mouse
Family 8
Subfamily g
Pseudo No
Location chr9:39819641-39820573 (+)
Aliases Olfr970, MOR171-16

Sequence information


Nucleotide sequence

ATGTTAAAAGGAAATCTTTCTGAAGTGACTGAGTTCATCCTCGCTGGGTTAACAAACAAA
CCAGAGCTGCAGCTGCCCCTCTTCCTCCTCTTTCTAGCAATCTATGTGGTCACAGTGGTG
GGGAATCTGGGTATGATTATCCTGATATTACTCAGTTCTCACCTTCACACACCCATGTAT
TATTTCCTCAGCAGTCTGTCTTTCATTGACCTCTGCCAGTCCACTGTCATTATTCCCAAA
ATGTTGGTGAACTTTGTGACAGTGAAGAACATCATCTCCTATCCTGAATGTATGACTCAG
CTCTACTTTTTTGTTACTTTTGCTATTGCAGAGTGTCACATGTTAGCTGTAATGGCATAT
GATCGCTATGTTGCAATCTGTAACCCCTTGCTTTACAATGCTGTAATGTCCTTTCAAGTC
TGTTCCTCAATGATATTTGGGGTATATAGTATAGCTTTAATTGGTGCCACAACTCACACA
GTCTGCATGTTAAGAGTGAATTTCTGTAAGGCAAATGTGATAAATCATTACTTCTGTGAT
CTTTTTCCACTCCTGGAACTCCCCTGTTCTGATACTTTTATTAATGAAGTAGTAGTTTTA
TGTTTCAGTGTTTTTAACATCTTTATTCCCACTCTGACTATTTTAACCTCTTACATCTTC
ATCATAGCCAGCATCCTCCGGATTAAATCCACTGAAGGCAGGTCCAAAGCCTTCAGCACC
TGCAGCTCACACATATCAGCTGTTGCTATCTTCTTCGGTTCCCTTGCATTCATGTACTTG
CAGCCATCATCAGTCAGCTCCATGGACCAAGGGAAAGTGTCCTCTGTATTTTATACCATT
GTTGTGCCCATGCTGAATCCCTTGATCTACAGCCTGAGAAATAAGGATGTCAAAGTTGCT
CTAAATAAGTTCTTTGAAAGAAAGTTTTTCTTA


Conceptual translation

MLKGNLSEVTEFILAGLTNKPELQLPLFLLFLAIYVVTVVGNLGMIILILLSSHLHTPMY
YFLSSLSFIDLCQSTVIIPKMLVNFVTVKNIISYPECMTQLYFFVTFAIAECHMLAVMAY
DRYVAICNPLLYNAVMSFQVCSSMIFGVYSIALIGATTHTVCMLRVNFCKANVINHYFCD
LFPLLELPCSDTFINEVVVLCFSVFNIFIPTLTILTSYIFIIASILRIKSTEGRSKAFST
CSSHISAVAIFFGSLAFMYLQPSSVSSMDQGKVSSVFYTIVVPMLNPLIYSLRNKDVKVA
LNKFFERKFFL