Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8h10 Olfactory Receptor

Gene Symbol Or8h10
Organism Mouse
Family 8
Subfamily h
Pseudo No
Location chr2:86,977,800-86,978,800 (-)
Aliases Olfr1100

Sequence information


Nucleotide sequence

MNTWNYTKESDFILMGLTDSKEIQLVLTVLFVLIYLVTVLGNAGMMLIIRLDAQLHTPMY
FFLSHLSFLDLSYSTVITPKTLQNLLTSTKVISFIGCFTQMYAFVLLAAAECFLLASMAY
DRYVAICNPLQYPVIMSTRFCSTLLTGSYMIGTMDSTVNIFCMNTLYFCRTKVIHHFFCD
TSPILALSCSDTRNIQIIIFIFAGSTLVVSLITISASYVSILSTILKINSTSGKHKAFST
CASHLLGVTVFYGTLIFTYLKPSNSYYSGKEQVASVFYTIVIPMLNPLIYSLRNKEVKSA
IHRVIKKQKGSRLKFRVALSD


Conceptual translation

MNTWNYTKESDFILMGLTDSKEIQLVLTVLFVLIYLVTVLGNAGMMLIIRLDAQLHTPMY
FFLSHLSFLDLSYSTVITPKTLQNLLTSTKVISFIGCFTQMYAFVLLAAAECFLLASMAY
DRYVAICNPLQYPVIMSTRFCSTLLTGSYMIGTMDSTVNIFCMNTLYFCRTKVIHHFFCD
TSPILALSCSDTRNIQIIIFIFAGSTLVVSLITISASYVSILSTILKINSTSGKHKAFST
CASHLLGVTVFYGTLIFTYLKPSNSYYSGKEQVASVFYTIVIPMLNPLIYSLRNKEVKSA
IHRVIKKQKGSRLKFRVALSD