Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8h10c Olfactory Receptor

Gene Symbol Or8h10c
Organism Rat
Family 8
Subfamily h
Pseudo No
Location chr3:74,523,700-74,524,700 (+)
Aliases Olr530

Sequence information


Nucleotide sequence

ATGAGCACCTGGAATTACACAAAAGAGTCTGACTTCATCCTCATGGGGCTGACAGATTCC
AAAGAGTTACAGCTAGTCCTCCCTGTTCTGTTTCTGCTGATGTACCTGGTCACTGTGCTG
GGAAACACAGGCATGATGCTGATCATCCGTCTAGATGCTCGGCTTCACACTCCAATGTAT
TTCTTCCTCACCCATCTGTCATTCCTTGACCTCTGTTACTCAACTGTCATCACACCTAAG
ACTTTACAGAATCTGCTGACTTCCAACAAAATCATTTCCTTTATTGGCTGTTTCACTCAG
ATGTATGGTTTTGTCCTCTTGGCTGCTGCTGAATGTTTCCTTCTTGCTTCAATGTCCTAT
GACAGATATGTGGCTATCTGCAACCCTTTACACTACCCAGTTATCATGTCCACAAGGTTC
TGCAGTGCCCTTCTCACTGGTTCCTATATGATTGGAACTTTGGATGCCACTGTTAATATA
CTTTGTATGAATACCTTATACTTCTGCAGACCCAAGGTTATCCATCATTTTTTCTGTGAC
ACGTCCCCAATTTTAGTACTGTCTTGTAATGATACGCATAACATTGAAATCATTATATTC
ATCTTTGCTGGTTCTACTCTAATGGTGTCTCTTATCACAATATCTTCCTCCTATATGTCC
ATTCTGTCTACGATTTTGAAGATCAATTCCACTTCAGGAAAGCACAAAGCCTTCTCCACT
TGTGCCTCTCATCTCCTAGGAGTCACTGTGCTTTATAGTAATATTATTTTTACTTATTTG
AAACCAAGTAATTCCTACTCCTTGGGAAAGGATCAAGTGGCTTCTGTTTTCTATACTATT
GTGATCCCCATGCTGAACCCACTCATTTATAGTCTCAGAAACAAAGAAGTGAAAAATGCT
GTTCATAGAGTTATCAAAAAGCAGGAAGGCTCAAGGCTTCAGATCAGAGTGACACTTAGT
AAT


Conceptual translation

MSTWNYTKESDFILMGLTDSKELQLVLPVLFLLMYLVTVLGNTGMMLIIRLDARLHTPMY
FFLTHLSFLDLCYSTVITPKTLQNLLTSNKIISFIGCFTQMYGFVLLAAAECFLLASMSY
DRYVAICNPLHYPVIMSTRFCSALLTGSYMIGTLDATVNILCMNTLYFCRPKVIHHFFCD
TSPILVLSCNDTHNIEIIIFIFAGSTLMVSLITISSSYMSILSTILKINSTSGKHKAFST
CASHLLGVTVLYSNIIFTYLKPSNSYSLGKDQVASVFYTIVIPMLNPLIYSLRNKEVKNA
VHRVIKKQEGSRLQIRVTLSN