Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8h6b-ps Olfactory Receptor

Gene Symbol Or8h6b-ps
Organism Rat
Family 8
Subfamily h
Pseudo Yes
Location chr3:74297729-74298673 (+)
Aliases Olr523-ps, Olr523-ps, Olr521-ps

Sequence information


Nucleotide sequence

ATGAACACTTGGAATCACACAAATAAACCAGACTTCATCCTCATGGGATTGACAGATTCC
AAAGAAATCCAGCTGGCTCTCTCTGTGCTGTTTCTGCTGATATACCTGGTCAATGTGCTG
GGGAACACAGGCATGATGCTGATCATCCGTCTAGATGCTCGGCTTCACACTCCCATGTAT
TTCTTCCTCACACATCTGTCATTTCTTGACCTCAGTTACTCAACCGCCATCACACCAAAA
ACTTTAGAGAGCCTCCTAACAGCTAACAATACCATTTCCTACACAGATTGTTTCACCCAA
CTGTACATTTTTATCCTCTTAGCAGCTACTGAATGTTTTCTGCTCTCCTCAATGTCCTAT
GACCGCTACATAGCCATTTGTAACCCTTTACAGTACCCAGTTATTATGTCTTCACAGTGA
TGCCTTGCTCTCCTCACTGGTTCCTATGTAATTGGAGCTGTGGATTCCTCTGTCACTGTG
TTTGGCATGATTAGCCTGCATTTCTGCAAGACCAACATCATCCATCATTTTTACTGTGAC
ACATCTCCTCTTCTATCTCTGTCTTGCAGTGACACACATGTAGTTAAAATCATTATATTC
ATTTTTGCAGGTTCCACAATTCTGGGCTCCCTTATCACAATATCCGTATCCTATGTATCC
ATTCTTTCTACTATTTTGAAGATAAATTCCACTTCAGGAAAGCAAAAAGCTTTTTCTACC
TGTGCTTCTCATCTTCTCGGAGTGACTGTTTTTTATAGCACTCTGATTTTTACTTATTTA
AAGCCAAGTAAGTCCTATTCTTTAGGAAAGGATCAAGTAGCTTCTATTTTCTATACAATT
GTGATCCCCATGCTAAATCCTCTTATTTATAGTCTCAGAAACAAAGAAGTCAAAAGTGCT
GTTTTTAGATTAGTGAAGAAGAGACAAGGATCTAGGAAGTTAAGA


Conceptual translation

MNTWNHTNKPDFILMGLTDSKEIQLALSVLFLLIYLVNVLGNTGMMLIIRLDARLHTPMY
FFLTHLSFLDLSYSTAITPKTLESLLTANNTISYTDCFTQLYIFILLAATECFLLSSMSY
DRYIAICNPLQYPVIMSSQ*CLALLTGSYVIGAVDSSVTVFGMISLHFCKTNIIHHFYCD
TSPLLSLSCSDTHVVKIIIFIFAGSTILGSLITISVSYVSILSTILKINSTSGKQKAFST
CASHLLGVTVFYSTLIFTYLKPSKSYSLGKDQVASIFYTIVIPMLNPLIYSLRNKEVKSA
VFRLVKKRQGSRKLR