Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8h7 Olfactory Receptor

Gene Symbol Or8h7
Organism Mouse
Family 8
Subfamily h
Pseudo No
Location chr2:86890229-86891173 (-)
Aliases Olfr1097, RP23-25M5.1, MGC123667, MGC123726, MOR206-2, RP23-25M5.1, MGC123667, MGC123726, MOR206-2

Sequence information


Nucleotide sequence

ATGAGTGCCTGTAATGATACAAATGAACCTGAGTTCACGCTTGTGGGACTGACAGACTCC
AAGGAGATTCAGCTGGTCCTCTCTGTTTTGTTTCTCCTGATATACATGCTCACTGTCTTG
GGAAACATAGGTATGATACTGATCATTCATCTAGATGTCCAGCTCCACACTCCAATGTAT
TTTTTCCTCACCCACTTGTCATTCCTTGACCTCAGTTACTCAACTGTAATCACACCTAAA
ACCTTACAGAATACGCTGACCTCCATAAAAAATATTTCCTTCATGGGATGCTTCACCCAG
TTGTATTTCTTTGTCCTCTTGGCAGCTTCTGAATGTTTTATACTTTCGTCAATGGCCTAT
GACCGCTATGTAGCTATCTGCAACCCTCTACACTATCCAGTTATTATGTCCCCTAGGCGC
TCATATACTCTCATCACTGTGTCCTACATGATTGGAGTTTTGGATTCTTCTGTCACTGTC
TTTTGCTTAAGCACACTGGATTTCTGCAACTCCAAAGTAATTCATCACTTCTTTTGTGAC
ACATTCCCAATTTTAGCTCTGTCCTGCAGTGATACCTATAATGCAGAAGCCACTATATTC
GTTTTAGCTGGTTCCACTCTATTGCTGTCGCTCATCACGATATCCTCATCCTATGTATCT
ATTCTCTCTACAATTTTGAAGATAAATTCTTCTTCAGGAAAGCACAAAGCCTTCTCTACA
TGTGCCTCACATCTTATAGGAGTCACTGTTTTTTATGGTACAATGATCTTTACTTATTTA
AAACCAAGTACGTCCTACTCCCTGGGAAAGGATCAAGTAGCCTCTGTTTTTTATACTATA
GTGATTCCCATGCTGAACCCACTTATCTATAGTCTCAGGAACAAAGAAGTGAAAAGTGCT
GTTGTTAGAGTTATGAAGAAGAGAGAGTGCACCCAGAAACTAAAA


Conceptual translation

MSACNDTNEPEFTLVGLTDSKEIQLVLSVLFLLIYMLTVLGNIGMILIIHLDVQLHTPMY
FFLTHLSFLDLSYSTVITPKTLQNTLTSIKNISFMGCFTQLYFFVLLAASECFILSSMAY
DRYVAICNPLHYPVIMSPRRSYTLITVSYMIGVLDSSVTVFCLSTLDFCNSKVIHHFFCD
TFPILALSCSDTYNAEATIFVLAGSTLLLSLITISSSYVSILSTILKINSSSGKHKAFST
CASHLIGVTVFYGTMIFTYLKPSTSYSLGKDQVASVFYTIVIPMLNPLIYSLRNKEVKSA
VVRVMKKRECTQKLK