Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8h9 Olfactory Receptor

Gene Symbol Or8h9
Organism Rat
Family 8
Subfamily h
Pseudo No
Location chr3:74502165-74503106 (-)
Aliases Olr529, Olr529

Sequence information


Nucleotide sequence

ATGAATACCTGGAATTATACAAATAAACTTGATTTCATCCTCATGGGGCTGACAGATTCC
AAGGAGGTCCAGCTGGTCCTCTCTGTGCTGTTTCTCCTGATATACATGCTCACTGTGTTA
GGGAACGTAGGCATGATACTTATCATTCGTCTAGATGTTCAGCTTCACACTCCCATGTAC
TTTTTCCTCACCCACTTGTCTTTCCTTGACCTCACTTACTCAACTGTCATTACACCTAAA
ACTTTAGAAAACCTGATGACTTCCACTAAGAACATTTCCTTTGTGGGCTGCTTCACCCAA
ATGTACTTTTTTGTTCTTTTGGCAGCTACTGAGTGTTTCCTTCTGTCCTCAATGGCTTAT
GATAGGTATGTAGCCATCTGTAGTCCTCTACATTATTCGGTCATTATGTCCAACAGATTC
TGCAGTACCCTCCTTACTCTGTCATATGTGTTTGGAGCTGTAGATTCCACAGTCAATATG
TTGTGCATGGGTACACTGGATTTCTGCAACTCCAATGTCATCCATGACTTTTTCTGTGAC
ACATCCCCACTTATAGCCCTCTCATGCAGCAACACACATGACATTGAATCCATTATATTT
ATCTTTGCTGGTTCCACTCTACTGCTGTCCCTTATCACAATATCTGCATCTTATGTGTCA
ATCTTCTCTACTATTTTGAAGATCAATTCCACCTCAGGAAAGCAAAAGGCCTTCTCAACT
TGTGCTTCTCATATTCTGGCAGTTACCATATTTTATGGTACCATGATCTTCACTCATTTA
AAATCAAATAAGTCTTTCTCCTTGGGTAAGGATCAAGTGGCTTCTGTTTTCTATACTATT
GTGATTCCCATGCTGAACCCACTCATTTATAGTCTCAGAAACAAAGAAGTAAAATGTGCT
ATTGGTAGAATTATAAGGAAAGGAGAGAAAGTTCTGAACTAC


Conceptual translation

MNTWNYTNKLDFILMGLTDSKEVQLVLSVLFLLIYMLTVLGNVGMILIIRLDVQLHTPMY
FFLTHLSFLDLTYSTVITPKTLENLMTSTKNISFVGCFTQMYFFVLLAATECFLLSSMAY
DRYVAICSPLHYSVIMSNRFCSTLLTLSYVFGAVDSTVNMLCMGTLDFCNSNVIHDFFCD
TSPLIALSCSNTHDIESIIFIFAGSTLLLSLITISASYVSIFSTILKINSTSGKQKAFST
CASHILAVTIFYGTMIFTHLKSNKSFSLGKDQVASVFYTIVIPMLNPLIYSLRNKEVKCA
IGRIIRKGEKVLNY