Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8i14-ps Olfactory Receptor

Gene Symbol Or8i14-ps
Organism Rat
Family 8
Subfamily i
Pseudo Yes
Location chr3:78093553-78094397 (+)
Aliases Olr692-ps, Olr692-ps

Sequence information


Nucleotide sequence

TCTTTTTTATCTGCCAGTGTACTCTTTACTCAATGAATTAACTTTTATAGAAGTATACTT
TGCCTCTTGTGTGACTCCAAAATTCACTGGCAACCTGCTGGTAGCGAAAAAAAGTCATCT
CCCATCCTAACTGTATGCTATAGGTCTTTGCTACGCATTTCTTTGAATAATTGAAATCTT
AATCTTGGCAGGATCTTCTGTGACTGCTGTGTGTTCTTCTGCAGGGCTCTCCACAGCATG
GTCGTCATTAGCAGGACAAAATGCCACTTCTAATATTAGCAACTTGCTGGTGGAGCAGCC
CACTTCTTTCCTCAGTTTTCTATTGTAATACTGTTGCCCTTTTGTCACCCCAAATTGAGC
ACTACTTCTGTGAAATCTATTCAAAGTTTTCTGTACTTACACCTACAGGAATGGTCTCCT
TGTTCTGGCCAATTCAGGAATAATCACGTTAGTGGCTCTTATGGTTTTGTTTGCTTCTTA
TGTCATTATTTTATTCATGTTAAGAACACACGTAGCAGAAGGAAGAAGAAAAGCCCTGGC
TACATGTGGCATTCTAATACCCCTAATAGTTTTAGTCTTTGGATCTCTATCTTTCCCTAA
GTTAGACCTGCTACCGTTTTCCCTGAAAATATTATATTGCAATGTTTTATACCATAACTA
AACCTATGTCAATCTACCAATTTACAAGCTGAGAAATGCAGAGATGAAAAGCGCAGTAAA
GATTTTATTTACCTATACAAATTAGGGTGTGTGGCTTTAAAATAGAAATTTGTACATGTA
TTTAAATAGCTAGAAACTATGCTATCAATCTTCTGTATTTCACTGTCTTTAGTGGAATGG
ATGTG


Conceptual translation

FYLPVYSLLNELTFIEVYFASCVTPKFTGNLLVAKKS\SHPNCML*VFATHFF/IIEI
LILA/IFCDCCVFFCRALHSMVVISRTKCHF*Y*QLAGGAAHFFPQFSIVILLPFCHP/br/>NIEHYFCE/LFKVFCTYTYRNGLLVLANSGIITLVALMVLFASYVIILFMLRTHVAEGR
RKALATCGILIPLIVLVF/ISIFP*VRP/YRFP*KYYIAMFYTITKPM/NLPIYKLR
NAEMKSAVKILF