Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8i2 Olfactory Receptor

Gene Symbol Or8i2
Organism Mouse
Family 8
Subfamily i
Pseudo No
Location chr2:87,021,600-87,022,500 (-)
Aliases Olfr1104

Sequence information


Nucleotide sequence

MTENNFTKVTVFMFSGFSDHPELQVSLFLIFLFIYLFTVWGNIGLILLIRIDSQLHTPMY
FFLSNLAFIDIFYSSTVTPKAVVDFQSTQKSISFVGCFVQMYFFVGLVCSECFLLGSMAY
DRYVAICNPLLYSVIMSQKVCNWLAVIPYMIGFTNSLISICVISSLPLCDPYINHFFCDT
TALLALSCVDAFSTELVIFVLAGFTLLSSLLIITFTYVTIISAILRIQSAAGRWKAFSTC
ASHLTGVTVFYGSLIFTYLQPDNTSSLTQAQVASVFYTIVIPMLNPLIYSLRNKDVKNAL
LRVIHRKHLL


Conceptual translation

MTENNFTKVTVFMFSGFSDHPELQVSLFLIFLFIYLFTVWGNIGLILLIRIDSQLHTPMY
FFLSNLAFIDIFYSSTVTPKAVVDFQSTQKSISFVGCFVQMYFFVGLVCSECFLLGSMAY
DRYVAICNPLLYSVIMSQKVCNWLAVIPYMIGFTNSLISICVISSLPLCDPYINHFFCDT
TALLALSCVDAFSTELVIFVLAGFTLLSSLLIITFTYVTIISAILRIQSAAGRWKAFSTC
ASHLTGVTVFYGSLIFTYLQPDNTSSLTQAQVASVFYTIVIPMLNPLIYSLRNKDVKNAL
LRVIHRKHLL