Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8i2 Olfactory Receptor

Gene Symbol Or8i2
Organism Rat
Family 8
Subfamily i
Pseudo No
Location chr3:74596464-74597393 (-)
Aliases Olr536, Olr536

Sequence information


Nucleotide sequence

ATGACAGAGAATAATTTCACAAAAGTGACAGTCTTCATGCTTAGTGGATTTTCAGATCAC
CCGGAATTACAAGTCAGTCTGTTCTTAATATTCCTTTTCATCTACTTATTCACTGTGTGG
GGCAACATTGGGTTGATCATGTTAATTAGAATTGACTCCCAGCTTCATACTCCTATGTAC
TTTTTCCTTAGCAATTTAGCATTCATTGACATATTTTATTCCTCCACTGTGACACCCAAG
GCACTAGTTGATTTCCAGTCCACACAGAAATCAATATCATTTGTAGGCTGCTTTGTTCAG
ATGTACTTCTTTGTCGGTTTAGTGTGCAGTGAGTGTTTCCTTCTGGGATCCATGGCTTAT
GATCGCTATGTAGCAATCTGCAATCCCTTACTATATTCTGTGATTATGTCCCAGAAGGTG
TGCAACTGGCTGGCAGTAATACCATACATGATAGGCTTCACAAATTCTCTGATATCCATC
TGTGTGATAAGCAGTTTGCCTCTCTGTGATCCCTATATTAATCATTTCTTTTGTGACACC
ACAGCTCTTTTAGCCCTGTCCTGTGTAGATGCCTTCAACACAGAATTGGTGATCTTTGTT
CTAGCTGGTTTCACACTCCTCAGTTCTCTTCTCATCATTACTTTCACTTATCTGACCATC
ATCTCAGCCATCCTTAAGATTCAGTCAGCAGCTGGCAGGTGCAAGGCTTTTTCTACATGT
GCCTCTCACCTCACAGGTGTCACTGTCTTCTATGGCTCCTTGATTTTCACCTATTTGCAA
CCTGATAACACATCATCCCTCACCCAAGCTCAGGTAGCCTCTGTATTCTACACCATTGTC
ATTCCCATGCTGAACCCACTGATCTACAGTCTGAGAAACAAAGATGTGAAAAATGCTCTT
CTGAGAGTCATTGACAGAAAACTCTTTTTG


Conceptual translation

MTENNFTKVTVFMLSGFSDHPELQVSLFLIFLFIYLFTVWGNIGLIMLIRIDSQLHTPMY
FFLSNLAFIDIFYSSTVTPKALVDFQSTQKSISFVGCFVQMYFFVGLVCSECFLLGSMAY
DRYVAICNPLLYSVIMSQKVCNWLAVIPYMIGFTNSLISICVISSLPLCDPYINHFFCDT
TALLALSCVDAFNTELVIFVLAGFTLLSSLLIITFTYLTIISAILKIQSAAGRCKAFSTC
ASHLTGVTVFYGSLIFTYLQPDNTSSLTQAQVASVFYTIVIPMLNPLIYSLRNKDVKNAL
LRVIDRKLFL