Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8i7-ps Olfactory Receptor

Gene Symbol Or8i7-ps
Organism Rat
Family 8
Subfamily i
Pseudo Yes
Location chr3:76,683,000-76,684,100 (-)
Aliases Olr628-ps

Sequence information


Conceptual translation

MENQKNVSQFTLLGLFNDHNIQVL*FILFLVCYMSFLVGKTALFIWI*\AFFFFHLLIY
SFLSNVTFIDLYFPSCVTPKFTGNLLVMRKVISYPKCML*FFAMHFF/IIEIFIMTGIF
CDCCVFFCRV/HSMVIINRTK/SLLI*AAWLV/AAHFFAQFSIAILLPF/TPQTEH
YFCEICSKFSVLTVLANSGIVTLVALMVLFASNVIILFTLRTHLAEGRRKAKVTSGIQIT
LKILVFRPQIFSYFKPPTSFPEDIVLAMFYTIAVPM/NPPIYKLRN