Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8j10-ps Olfactory Receptor

Gene Symbol Or8j10-ps
Organism Rat
Family 8
Subfamily j
Pseudo Yes
Location chr3:73593027-73594121 (+)
Aliases Olr489-ps, Olr489-ps

Sequence information


Nucleotide sequence

AAACTATTATGTAAGACAGACGAAAATAGTGATCTGTTAATGTTTTATTTTCCACACTAA
AAGATGAACGTATAATGCTCCATGGAATCCCACTCATGTCATGGAGTTTATATTCATGGG
CGTGTCTGACCGTCCAGATCTGTAGGTACCACTTTTCTTTCTCTTCTTGGTCATTTACCC
TCTGAGAGCAGCGGTTTATCTGGGCATCATCACTGTCACCACCATAGACTCATGACTGCA
AACTCCCATGTACTTCTTCCTCAGACACCTGGCGGTCATGAACTTTAACAACTCAACTGT
CATTGCTCCTGAAATGCTTGTCAACTTCTTATTCACATGAAAACCACCTTATACTATGAA
TGTGCCACGCAGCTAGGAGGATTCCTCATTTTCATTGTAGCAGAGATCTTCATGCTGCTA
TGAAGGCCTATGATCACTATGTGGCCACCTGCAACCCCCTGCTCTATGTGGTATCTCGAC
GGGTTTGCCTGCTGCTGGTGTTTTTCACATACCTCTTTAGCTTTGTCACAGGCATTTTTT
GTGGTACTTTGTGTGTTCTCTGTTTCTTATTGCTGTAATCAACCACTTTTACTGTGACAA
TGTCCCACTATTAGCTCTGTCCTGCTCTGACACTCACCTTCCAGGAACTGTTGTATTTTC
TCAGCAACAAACTTGTTTTTCTCGATGATCATTGTACTTGTATCCATCCTATTTCAACAT
AATACTTGCAATTTTGAGGATTTGTTCATCTGAAGCAAGGAAGAAAAGAAAGCCTTCTCT
ACTTGTGCTTCCCACATGATGGCTGTGGCTGTGTTCTACGGCACATTTCTCTTCATGTAT
CTGCAACCAGGGACTAATTATTCCTTAGACACTGACAAGATGGGTTCTTGCTCTACACAT
TAGTGATACCAATGTTGAACCCTATCATCTATAGCTTTAGGAACAAGGGTGTAAAGTGTT
CATTGAAAGAATTCCTAAGTAATGCATGCAAATGATTCAATCTTATATGCATTTTTAGCG
ATAATTTTTTAACTTAAAATGTCTTCCCTCTTTAAAAAACAATCACTGTTCTTCAAAGAT
GTTCGTGGTAAATGT


Conceptual translation

MEFIFMGVSDRPDL*VPLFFLFLVIYPLRAAVYLGIITVTTIDS*LQTPMYFFLRHLAVM
NFNNSTVIAPEMLVNFLFT*/TTLYYECATQLGGFLIFIVAEIFMLL*/AYDHYVATC
NPLLYVVSRRVCLLLVFFTYLFSFVTGIFCGTLCVLCF/IAVINHFYCDNVPLLALSCS
DTHL\ELLYFLSNKLVFL/*SLYLYPSYFNIILAILRICSSEARKK/KAFSTCASHM
MAVAVFYGTFLFMYLQPGTNYSLDTDKMGSC/YTLVIPMLNPIIYSFRNKGVKCSLKEF
L