Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8j3 Olfactory Receptor

Gene Symbol Or8j3
Organism Mouse
Family 8
Subfamily j
Pseudo No
Location chr2:86197806-86198750 (-)
Aliases Olfr1045, RP23-232A21.8, MOR185-2, RP23-232A21.8, MOR185-2

Sequence information


Nucleotide sequence

ATGGCTCCTAGAAATTTATCTCATGTCACTGAGTTCATTCTTGTCGGTGTTTCAGACCTT
CCAGAACTTCAGGTTCCACTTTTCTTTGTCTTCCTAGTTATCTACCTTCTGACAGCAGCA
GGGAACCTGGGCATCATCACCCTGACCTCCGTGGACTCACGCCTGCAAACTCCCATGTAC
TTCTTCCTCAGACACCTGGCGGTCATCAACTTTGGCAACTCCACTGTCATTGCTCCTAAA
ATGCTGGTCAACTTCTTAGTCAGTAAGAAAACCACTTTATACTACGAATGTGCCACTCAG
CTGGGAGGATTCCTGGTTTTCATTGTAGCAGAGATCTTTATGCTCGCTGTGATGGCCTAT
GACCGCTATGTGGCCATCTGCAACCCACTGCTCTACATGGTGGTGGTGTCTCGACGGGTC
TGCCTTCTGTTGGTGTCGCTCACATACTTCTATGGCTTTTGCACAGCCATTGTCGTTTCA
TCCTGTGTGTTCTCTGTGTCTTATTGCTCCTCCAAAAAAATAAACCATTTTTACTGTGAT
AATGTCCCTCTCTTGGCACTTTCCTGCTCTGACACCTACCTTCCAGAAACTGTAGTCTTT
ATATCTGCAGCTACAAACCTGTTCTTTTCCATGAGTATAGTGTTGGTATCTTATTTCAAC
ATCGTGTTGTCTATCCTAAGGATCCGTTCAGCAGAAGGAAGGAAAAAAGCCTTTTCCACC
TGTGCTTCACATGTGATGGCTGTCACAGTTTTCTATGGGACGCTGTTGTTTATGTATTTG
CAACCTCAAACTAACCACTCACTAGATACTGATAAGATGGCCTCTGTGTTTTACACCTTG
GTCATCCCAATGCTGAACCCCATGATCTACAGCCTGAGGAACAAGGATGTGAAGGCCGCT
TTAAAGAGATTCATGACAAGTCCATGTGATTCTTTTAAATCACTG


Conceptual translation

MAPRNLSHVTEFILVGVSDLPELQVPLFFVFLVIYLLTAAGNLGIITLTSVDSRLQTPMY
FFLRHLAVINFGNSTVIAPKMLVNFLVSKKTTLYYECATQLGGFLVFIVAEIFMLAVMAY
DRYVAICNPLLYMVVVSRRVCLLLVSLTYFYGFCTAIVVSSCVFSVSYCSSKKINHFYCD
NVPLLALSCSDTYLPETVVFISAATNLFFSMSIVLVSYFNIVLSILRIRSAEGRKKAFST
CASHVMAVTVFYGTLLFMYLQPQTNHSLDTDKMASVFYTLVIPMLNPMIYSLRNKDVKAA
LKRFMTSPCDSFKSL