Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8j3 Olfactory Receptor

Gene Symbol Or8j3
Organism Rat
Family 8
Subfamily j
Pseudo No
Location chr3:73522102-73523043 (-)
Aliases Olr484, Olr484

Sequence information


Nucleotide sequence

ATGGCTCCTAGAAATTTATCTCATATCACTGAATTCATTCTTGTGGGAGTTTCAGACCTT
CCAGAACTTCAGGTTCCACTTTTCTTTGTCTTCCTAATCATCTACCTTCTGACAGCAGCG
GGGAACCTGGGCATCATCACCCTCACCACCGTGGACTCACGACTGCAAACACCCATGTAC
TTCTTCCTCAGACACCTGGCGGTCATCAACTTCGGCAACTCAACTGTCATTGCTCCTAAA
ATGCTGGTCAACTTCTTAGTCACAGAGAAAACTACCTTATACTATGAATGTGCCACGCAG
TTAGGAGGATTCCTGGTTTTCATTGTAGCAGAGATCTTCATGCTCGCTGTGATGGCCTAT
GACCGCTATGTGGCCATCTGCAACCCACTGCTCTATATGGTGGTGGTGTCTCGACGCGTC
TGCCTTCTGCTCATGTCCTTAACATACTTCTATGGCTTTTGCACAGCCATTGTTGTTTCA
TCATGTGTGTTCTCTGTGTCTTATTGCTCCTCCAAGAAAATCAACCATTTTTACTGTGAT
AATGTCCCTCTCTTAGCACTTTCCTGTTCTGACACCTACCTTCCAGAAACTGTAGTCTTT
ATATCTGCAGCTACAAACTTGTTCTTTTCCATGAGTATAGTGCTGGTATCTTATTTCAAT
ATTGTGTTGTCTATCCTAAGGATCCGTTCATCAGAAGGAAGGAAAAAAGCCTTTTCCACC
TGTGCTTCACATATGATGGCTGTCACAGTTTTCTATGGGACACTGCTGTTTATGTATTTG
CAACCTCAGACTAACCACTCACTAGATACTGATAAGATGGCCTCTGTGTTTTATACATTG
GTGATACCAATGCTGAACCCCATGATCTACAGCCTGAGGAACAAGGACGTGAAGGCCGCT
TTAAAGAAATTCATTACAAATCCATGTGATTCTTTCAAATCA


Conceptual translation

MAPRNLSHITEFILVGVSDLPELQVPLFFVFLIIYLLTAAGNLGIITLTTVDSRLQTPMY
FFLRHLAVINFGNSTVIAPKMLVNFLVTEKTTLYYECATQLGGFLVFIVAEIFMLAVMAY
DRYVAICNPLLYMVVVSRRVCLLLMSLTYFYGFCTAIVVSSCVFSVSYCSSKKINHFYCD
NVPLLALSCSDTYLPETVVFISAATNLFFSMSIVLVSYFNIVLSILRIRSSEGRKKAFST
CASHMMAVTVFYGTLLFMYLQPQTNHSLDTDKMASVFYTLVIPMLNPMIYSLRNKDVKAA
LKKFITNPCDSFKS