Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8j3b Olfactory Receptor

Gene Symbol Or8j3b
Organism Rat
Family 8
Subfamily j
Pseudo No
Location chr3:73668055-73668999 (-)
Aliases Olr495, Olr495

Sequence information


Nucleotide sequence

ATGGCTCCAGGGAATCTCACTCATGTAACAGAGTTTATACTCATGGGGGTATCTGACCGT
CCGGAACTTCAGGTACCACTTTTCTTTCTCTTCTTGGTCATTTACCTTCTGACAGCTGCA
GGGAACCTGGGCATCATCACCCTCACCACTGTGGACTCACGACTGCAAACACCCATGTAC
TTTTTCCTCAGACACTTGGCGGTCATCAACTTCGGCAACTCAACTGTCATTGCTCCTAAA
ATGCTGGTCAACTTCTTAGTCACAGAGAAAACTACCTTATATTATGAATGTGCCACGCAG
CTAGGGGGATTCCTCGTTTTCATTGTAGCAGAGATCTTCATGCTTGCTGTGATGGCCTAT
GACCGCTATGTGGCCATCTGCAACCCACTGCTCTATATGGTGGTGGTGTCTCGACGGGTC
TGCCTTCTGCTGGTGTTTTTCACATACCTCTTTAGTTTTGTCACAGCCATTGTTGTGACA
CCTTGTGTGTTCTCTGTTTCTTATTGCTCTTCCAATGTAATCAACCACTTTTACTGTGAC
AATGTCCCATTATTAGCTCTGTCCTGCTCCGACACTCACCTTCCAGAAACTGTTGTATTT
TTTTTCTCAGCAACAAACCTGTTTTTCTCAATGATCATTGTTCTCATATCCTATTTCAAC
ATAATACTTGCAATTTTGAGGATCCGTTCATCTGAAGGAAGGAAGAAAGCCTTCTCCACT
TGTGCTTCCCACATGATGGCTGTCACTGTGTTCTACGGTACACTTCTCTTCATGTACCTA
CAACCACGGACTAATCACTCCTTAGACACTGACAAGATGGCCTCTGTGTTCTACACCTTA
GTAATACCAATGTTGAACCCTGTCATCTATAGCTTTAGGAACAAGGATGTAAAGTGTGCA
TTGAAAGAATTCCTAAAAAATCCATGCAAACGATTCAATCTTATA


Conceptual translation

MAPGNLTHVTEFILMGVSDRPELQVPLFFLFLVIYLLTAAGNLGIITLTTVDSRLQTPMY
FFLRHLAVINFGNSTVIAPKMLVNFLVTEKTTLYYECATQLGGFLVFIVAEIFMLAVMAY
DRYVAICNPLLYMVVVSRRVCLLLVFFTYLFSFVTAIVVTPCVFSVSYCSSNVINHFYCD
NVPLLALSCSDTHLPETVVFFFSATNLFFSMIIVLISYFNIILAILRIRSSEGRKKAFST
CASHMMAVTVFYGTLLFMYLQPRTNHSLDTDKMASVFYTLVIPMLNPVIYSFRNKDVKCA
LKEFLKNPCKRFNLI