Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8j3c Olfactory Receptor

Gene Symbol Or8j3c
Organism Mouse
Family 8
Subfamily j
Pseudo No
Location chr2:86422730-86423674 (-)
Aliases Olfr1062, MOR185-1, MOR185-1

Sequence information


Nucleotide sequence

ATGGCAACAGGGAATCTCACTCATGTCACGGAGTTCATACTCATGGGGGTAACTGACCGT
CCAGAACTGCAGGTTCCACTTTTCTTTCTCTTCTTAGTCATCTACCTTCTGACAGCAGCA
GGGAACCTGGGCATCATCACCCTGACCTCCGTGGACTCACGCCTGCAAACTCCCATGTAC
TTCTTCCTCAGACACCTGGCGGTCATCAACTTTGGCAACTCCACTGTCATTGCTCCTAAA
ATGCTGGTCAACTTCTTAGTCAGTAAAAAAACCACCTTATACTATGAATGTGCCACGCAG
CTGGGAGGATTTCTGGTTTTCATGGTATCAGAGATCTTCATGCTGGCTGTGATGGCCTAT
GACCGCTATGTGGCCATCTGCAACCCACTGCTCTACATGGTGGTGGTGTCTCGACGGGTC
TGCCTTCTGCTGGTGTTTCTCACTTACCTCTTTAGCTTTGTCACAGCCATTGTTGTGACA
CCTTGTGTGTTCTCTGTTTCTTATTGCTCTTCCAATGTAATCAACCACTTTTACTGTGAC
AATGTCCCTCTGTTAGCTCTGTCCTGCTCTGACACTCACCTTCCAGAAACTGTTGTATTT
TTTTTCTCAGCGACAAACTTGTTTTTCTCTATGATTATTGTACTTATATCCTATTTCAAC
ATAGTACTTGCAATTTTGAGGATCCGTTCATCTGAAGGAAGGAAGAAAGCCTTCTCTACT
TGTGCTTCTCACATGATGGCTGTCACTGTGTTCTATGGCACACTTCTCTTCATGTATCTA
CAACCACGGACTAATCACTCCTTAGACACTGACAAGATCGCTTCTGTGTTCTACACCCTA
ATAATACCAATGTTGAACCCTGTCATCTATAGCTTGAGAAACAAGGATGTAAAGTGTGCA
TTGAAAGAATTCCTAAAAAATCCATGCAAAAAATTCAATCTTATA


Conceptual translation

MATGNLTHVTEFILMGVTDRPELQVPLFFLFLVIYLLTAAGNLGIITLTSVDSRLQTPMY
FFLRHLAVINFGNSTVIAPKMLVNFLVSKKTTLYYECATQLGGFLVFMVSEIFMLAVMAY
DRYVAICNPLLYMVVVSRRVCLLLVFLTYLFSFVTAIVVTPCVFSVSYCSSNVINHFYCD
NVPLLALSCSDTHLPETVVFFFSATNLFFSMIIVLISYFNIVLAILRIRSSEGRKKAFST
CASHMMAVTVFYGTLLFMYLQPRTNHSLDTDKIASVFYTLIIPMLNPVIYSLRNKDVKCA
LKEFLKNPCKKFNLI