Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8k1 Olfactory Receptor

Gene Symbol Or8k1
Organism Mouse
Family 8
Subfamily k
Pseudo No
Location chr2:86216761-86217708 (-)
Aliases Olfr1046, RP23-232A21.9, MOR194-1, RP23-232A21.9, MOR194-1

Sequence information


Nucleotide sequence

ATGGAGAAATCCAACCACAGTGCGAGGATCCAGGTCACTGAATTTATTCTCTTGGGACTC
ACCAACAACCCAGGCCTCAAAGCACCACTCTTTGTAATATTTTTAATCATATATTTGGTA
ACACTGATGGGCAATCTGGGCATGGTTATCCTGACTCATGTAGACTCGAAACTACATACT
CCTATGTACTTTTTCCTGAGACATTTATCAATCACGGATCTTGGCTACTCTACAGTTATA
GGTCCAAAAATGATGGTAAACTTTGTAATGCAGCAGAATATCATTTCCTACACAGGGTGT
GCTGTGCAACTGACATTCTTTGAGATTTTCATCATTACTGAACTGTTTATCCTCTCAGCC
ATGGCTTATGACCGCTATGTAGCCATCTGCAAACCTCTTCTCTATGTGATCATCATGGCA
GGAAAAGTACGTTGGGGGCTGGTACTGGTACCCTATCTCTATAGCCTATTTGTGTCCTTA
CTTCTCACAGTTAAGTTATTCACACTGTCCTTTTGTGGCTCTAACATCATTAGTTACTTT
TATTGTGACTGTGTCCCTCTGATATCTCTGCTCTGTTCTGACACACATGAATTAGAACTG
ATTATTTTAATTTTCTCAGGCTGCAATTTACTCTCTTCCCTCCTCATTGTGCTGGTGTCT
TACATGTTCATTTTTGTGGCAATTCTCAGGATGAACTCCAAGGAGGGGAGGTCCAAAGCC
TTCTCCACGTGCAGCTCTCATCTGACAGTAGTGGTTGTGTTCTATGGAACACTGCTGTTT
ATTTACCTGCAACCCAAATCTAGTCATACTTTTGAAATTGATAAAATGGCCTCTGTGTTT
TATACACTAGTCATTCCTATGCTCAATCCATTGATATACAGCCTAAGAAACAAAGAAGTA
AAGGAGGCCCTTAAGAGAACTCTTACTCAGGGACTCAGAATCCACACT


Conceptual translation

MEKSNHSARIQVTEFILLGLTNNPGLKAPLFVIFLIIYLVTLMGNLGMVILTHVDSKLHT
PMYFFLRHLSITDLGYSTVIGPKMMVNFVMQQNIISYTGCAVQLTFFEIFIITELFILSA
MAYDRYVAICKPLLYVIIMAGKVRWGLVLVPYLYSLFVSLLLTVKLFTLSFCGSNIISYF
YCDCVPLISLLCSDTHELELIILIFSGCNLLSSLLIVLVSYMFIFVAILRMNSKEGRSKA
FSTCSSHLTVVVVFYGTLLFIYLQPKSSHTFEIDKMASVFYTLVIPMLNPLIYSLRNKEV
KEALKRTLTQGLRIHT