Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8k16 Olfactory Receptor

Gene Symbol Or8k16
Organism Mouse
Family 8
Subfamily k
Pseudo No
Location chr2:85689431-85690369 (+)
Aliases Olfr1008, RP23-16D18.12, MOR187-3, RP23-16D18.12, MOR187-3

Sequence information


Nucleotide sequence

ATGGGGCAACAGAATACAACATCACTGCCTGGGTTCATCTTGATGGGAATCACACAGAGC
ACTGAGCTTCAGCTTCCTTTGTTTGGGGTCTTCTTCATCATCTATGCAGTCACAGTCATG
GGCAACCTGGGCATGATCATTTTGACCAAGCTGGACTCTCGCCTACAAACCCCTATGTAC
TTTTTCATCAGACACCTGGCTTTCATTGATCTTGGAAATTCCACTGTCATCTGTCCCAAG
ATGCTGATGGATTTTGTTATGGATGAAAAAAACATTTCTTTTTATGCATGTGCCACACAG
ATGTCATTCTTTGTTTTGTTCATTATCAGTGAACTCTTTATCTTGTCCTCAATGGCCTAT
GACTGCTATGTGGCCATCTGCAACCCTCTGCTCTACAGTGTGATCATGTCTCAGAGACTT
TGCCATGTGCTTGTGGACATCCCATATCTCTACAGCACCTTCCAGGCTCTGCTATTCACC
AGTAAAATTTTCACATTAACTTTCTGTGGCTCTAACATCATCAGCCATTTCTACTGTGAT
GCTGTTTACTTGTTACCCACCTTGTGTTCAAATGCTGAAGAAATACAACTGCTGATCATA
TTATTTTCAGCATTGAATTTGCTCTCCTCTCTTCTGATAGTCCTTGGATTATATGTCCTG
ATTCTGATAGCCATATGTCGAATGCATTCTGCAGAAGGCAGAAGAAAAGCGTTCTCTACA
TGTGGGTCTCATCTGACAGTGGTTGTGGTGTTTTATGGTACTCTACTGTTTATGTACTTG
CAACCAAAATCTACTGACTCCTTAGAGAATGATAAAATAACCTCTGTGTTTTATACTTTA
GTGATCCCCATGATTAACCCCTTGATATACAGTTTAAGGAACAAAGAGGTAAAAAATGCT
TTCAACAGGGCATTAAAGAATCCATTTAAAATTAATACT


Conceptual translation

MGQQNTTSLPGFILMGITQSTELQLPLFGVFFIIYAVTVMGNLGMIILTKLDSRLQTPMY
FFIRHLAFIDLGNSTVICPKMLMDFVMDEKNISFYACATQMSFFVLFIISELFILSSMAY
DCYVAICNPLLYSVIMSQRLCHVLVDIPYLYSTFQALLFTSKIFTLTFCGSNIISHFYCD
AVYLLPTLCSNAEEIQLLIILFSALNLLSSLLIVLGLYVLILIAICRMHSAEGRRKAFST
CGSHLTVVVVFYGTLLFMYLQPKSTDSLENDKITSVFYTLVIPMINPLIYSLRNKEVKNA
FNRALKNPFKINT