Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8k17-ps Olfactory Receptor

Gene Symbol Or8k17-ps
Organism Rat
Family 8
Subfamily k
Pseudo Yes
Location chr3:73,567,700-73,568,600 (-)
Aliases Olr487-ps

Sequence information


Nucleotide sequence

ATGAGCCACAGAAACTCAACAGTGCCCGCTGAATTCATTCTGACTGGAATCACACAAAGG
CCTGAGCTGCAGCTTCTGCTTTTGGGGGTCTTCTTACTCATCTACAGTGTCTCCGTGATA
GGCAACATGAGCATGATCATTTTGACAAAGTTGGACTCTCACCTTCACACACCTATGTAT
TATTTTATCAGACACCTGGCTTTCATTGATCTTGGCAATTGCACTGTCATTTAACCCAAG
ATGATGGTGAATTTTGTGGTAGAACAAAATGTCATCTCTTACTATGCTTGTGCCATGCAG
ATGGCATTCTACATTGTTTTCATCATCAGTGAACTGTTTATATTGTCTGCAATGGCCTAT
GATCGCTATGTGGCCATCTGTAACCCTCTGCTCTACAGTGCAATCATGTCTCAGAGCCGC
TGTCATGTTCTGGTGGGCATTCCCTATCTCTACAGTGTCTTCCAAGCTGTGATGATAACT
AGTAAGATATTTACATTGACTTTCTGTGGCTCTAATATCATTAGCCATTTCTACTGTGAC
AATGTCCCCATGTTACTTTTACTGTGTTCAAATGCAAGGGATATAGAATTGTTGATTATA
TTATTTTCTGCAGTTAATTTGATCTCCTCACTCTTTGTAGTCTTAGTATCTTACCTTCTT
ATTCTACTCGCGATATATAAAATTCATTCTGCAGAAGGAAGGAAAAAGGCTTTGTCAACT
TGCGGTTCTCATCTGACAGTGGTGGTAGTATTTTATGGGACTCTACTTTTCATGTATTTA
CAGCCCAAATCTACCCACTCCTTTGAAACTGATAAACTAACATCTGTGTTTTATACTTTA
GTGATTCCCATGCTTAATCCCTTGATCTACAGCTTTAGAAACAAAGAGGTGAAAAATGCC
ATGCTAAGAGTTTTTAAGCGATGTAAACTTTGTACT


Conceptual translation

MSHRNSTVPAEFILTGITQRPELQLLLLGVFLLIYSVSVIGNMSMIILTKLDSHLHTPMY
YFIRHLAFIDLGNCTVI*PKMMVNFVVEQNVISYYACAMQMAFYIVFIISELFILSAMAY
DRYVAICNPLLYSAIMSQSRCHVLVGIPYLYSVFQAVMITSKIFTLTFCGSNIISHFYCD
NVPMLLLLCSNARDIELLIILFSAVNLISSLFVVLVSYLLILLAIYKIHSAEGRKKALST
CGSHLTVVVVFYGTLLFMYLQPKSTHSFETDKLTSVFYTLVIPMLNPLIYSFRNKEVKNA
MLRVFKRCKLCT