Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8k17 Olfactory Receptor

Gene Symbol Or8k17
Organism Mouse
Family 8
Subfamily k
Pseudo No
Location chr2:86,235,900-86,236,800 (-)
Aliases Olfr1048

Sequence information


Nucleotide sequence

MSFQKVEMSHRNSTVPDEFILTRITHRPELQLLLLGVFIVIYGVAMIGNMSMIILTKLDS
RLHTPMYYFIRHLAFIDLGNCTVIYPKMMVNFVVEQNVISYYACAVQMAFYIAFIISELF
ILSAMAYDRYVAICNPLLYSAIMSQRRCHVLVGIPYLYSVFQAVMITSKIFTLTFCDSNV
ISHFYCDNVPMLLLLCSNARDIELLIILFSALNLISSLFVVLVSYLLILLAIYRMHSADG
RKKAFSTCGSHLTVVVVFYGTLLFMYLQPKSTHSFETDKIASVFYTLVIPMLNPLIYSFR
NKEVKNAVLRVFRYQCKLCT


Conceptual translation

MSFQKVEMSHRNSTVPDEFILTRITHRPELQLLLLGVFIVIYGVAMIGNMSMIILTKLDS
RLHTPMYYFIRHLAFIDLGNCTVIYPKMMVNFVVEQNVISYYACAVQMAFYIAFIISELF
ILSAMAYDRYVAICNPLLYSAIMSQRRCHVLVGIPYLYSVFQAVMITSKIFTLTFCDSNV
ISHFYCDNVPMLLLLCSNARDIELLIILFSALNLISSLFVVLVSYLLILLAIYRMHSADG
RKKAFSTCGSHLTVVVVFYGTLLFMYLQPKSTHSFETDKIASVFYTLVIPMLNPLIYSFR
NKEVKNAVLRVFRYQCKLCT